SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01638

Identifier
MHCCLASSI  [View Relations]  [View Alignment]  
Accession
PR01638
No. of Motifs
4
Creation Date
31-DEC-2001
Title
MHC class I signature
Database References

PFAM; PF00129 MHC_1
INTERPRO; IPR001039 MHC_1
PDB; 1A9B; 1A1M
SCOP; 1A9B; 1A1M
CATH; 1A9B; 1A1M
Literature References
1. SPRINGER, S., DORING, K., SKIPPER, J.C., TOWNSEND, A.R. AND CERUNDOLO, V.
Fast association rates suggest a conformational change in the MHC class I
molecule H-2Db upon peptide binding.
BIOCHEMISTRY 37(9) 3001-3012 (1998).
 
2. KLEIN, J. AND FIGUEROA, F.
The evolution of class I major histocompatibility complex genes.
IMMUNOLOGY TODAY 7 41-44 (1986).
 
3. SMITH, K.J., REID, S.W., STUART, D.I., MCMICHAEL, A.J., JONES, E.Y.
AND BELL, J.I.
An altered position of the alpha 2 helix of MHC class I is revealed by the
crystal structure of HLA-B*3501.
IMMUNITY 4 203-213 (1996).
 
4. MENSSEN, R., ORTH, P., ZIEGLER, A. AND SAENGER, W.
Decamer-like conformation of a nona-peptide bound to HLA-B*3501 due to
non-standard positioning of the C terminus.
J.MOL.BIOL. 285 645-653 (1999). 

Documentation
Major Histocompatibility Complex (MHC) superfamily molecules are hetero-
dimeric cell surface receptors that function to present antigen peptide
fragments to T cells responsible for cell-mediated immune responses. MHC
molecules can be subdivided into two groups on the basis of structure and
function: class I molecules present intracellular antigen peptide fragments 
(~10 amino acids) on the surface of the host cells to cytotoxic T cells; 
class II molecules present exogenously derived antigenic peptides (~15 amino
acids) to helper T cells. MHC class I and II molecules are assembled and
loaded with their peptide ligands via different mechanisms. However, both
present T cells with antigen peptides for recognition and subsequent host
cell degradation.
 
Class I molecules are expressed on the surface of all somatic nucleated
cells, with the exception of neurons. Cytotoxic T cell receptors (TCR) are
able to recognise peptides, but only when they are complexed with MHC I
molecules on the surface of the host cell. Antigen peptide fragments are
generated within the cytosol of the host cell by the proteosome. These
peptides are then translocated from the cytoplasm to the rough endoplasmic
reticulum (RER) by the transporter of antigenic peptide (TAP) protein.
Inside the RER, some of these peptides bind to the MHC class I protein,
resulting in a change in conformation [1]. This allows for the association 
of beta-2 microglobulin, without which the MHC molecule would destabilise
and not be expressed on the cell surface.
 
MHC class I molecules comprise two chains [2]: the alpha chain consists
of three extracellular domains (alpha 1-3, alpha-1 being closest to the 
N-terminus and alpha-3 closest to the membrane), a  transmembrane region 
and a C-terminal cytoplasmic tail; the soluble extracellular beta-2
microglobulin chain associates primarily with the alpha-3 domain and is
necessary for MHC stability. A deep groove exists between the alpha-1 and
alpha-2 domains, which binds peptides in order to display them to the TCR.
 
The crystal structure of human major histocompatibility complex class I B
allele HLA B*3501 complexed with the 8-mer peptide epitope HIV1 Nef 75-82 
(VPLRPMTY) has been determined to 2.0A resolution [3]. The structure 
exhibits a novel conformation of the peptide within the binding groove [3].
Comparison with crystal structures of closely related alleles reveals
significant differences at both N- and C-termini, indicating a strong 
interdependence between the HLA class I molecule and the bound peptide [4].
 
MHCCLASSI is a 4-element fingerprint that provides a signature for the MHC
class I alpha chain. The fingerprint was derived from an initial alignment
of 17 sequences: the motifs were drawn from conserved regions spanning the
N-terminal half of the alignment - motif 1, which lies in the extracellular
alpha-1 domain, encodes alpha-helix 2; and motifs 2-4, which span the 
extracellular alpha-2 domain, encode beta-strand 5, strand 6, and the 
C-terminus of helix 4 and helix 5, respectively. Seven iterations on 
SPTR40_18f were required to reach convergence, at which point a true set
comprising 671 sequences was identified. Several partial matches were also
found, all of which are MHC class I and related proteins (including splice 
variants) that fail to make significant matches with one or more motifs.
Summary Information
 671 codes involving  4 elements
13 codes involving 3 elements
4 codes involving 2 elements
Composite Feature Index
4671671671671
3812136
22321
1234
True Positives
1A01_GORGO    1A01_HUMAN    1A01_PANTR    1A01_PONPY    
1A01_SAGOE 1A02_GORGO 1A02_HUMAN 1A02_PANTR
1A03_GORGO 1A03_HUMAN 1A03_PANTR 1A04_GORGO
1A04_PANTR 1A11_HUMAN 1A23_HUMAN 1A24_HUMAN
1A25_HUMAN 1A26_HUMAN 1A29_HUMAN 1A30_HUMAN
1A31_HUMAN 1A32_HUMAN 1A33_HUMAN 1A34_HUMAN
1A36_HUMAN 1A43_HUMAN 1A66_HUMAN 1A68_HUMAN
1A74_HUMAN 1A80_HUMAN 1B01_GORGO 1B01_SAGOE
1B02_GORGO 1B02_HUMAN 1B02_PANTR 1B03_GORGO
1B04_GORGO 1B04_HUMAN 1B05_HUMAN 1B07_HUMAN
1B08_HUMAN 1B10_HUMAN 1B11_HUMAN 1B12_HUMAN
1B13_HUMAN 1B14_HUMAN 1B15_HUMAN 1B16_HUMAN
1B18_HUMAN 1B19_HUMAN 1B20_HUMAN 1B21_HUMAN
1B22_HUMAN 1B23_HUMAN 1B25_HUMAN 1B26_HUMAN
1B27_HUMAN 1B28_HUMAN 1B29_HUMAN 1B31_HUMAN
1B32_HUMAN 1B34_HUMAN 1B35_HUMAN 1B36_HUMAN
1B38_HUMAN 1B39_HUMAN 1B41_HUMAN 1B42_HUMAN
1B43_HUMAN 1B44_HUMAN 1B45_HUMAN 1B46_HUMAN
1B47_HUMAN 1B48_HUMAN 1B49_HUMAN 1B52_HUMAN
1B53_HUMAN 1B54_HUMAN 1B55_HUMAN 1B56_HUMAN
1B57_HUMAN 1B58_HUMAN 1B59_HUMAN 1B60_HUMAN
1B61_HUMAN 1B62_HUMAN 1B63_HUMAN 1C01_GORGO
1C01_HUMAN 1C01_PANTR 1C01_SAGOE 1C02_GORGO
1C02_HUMAN 1C03_GORGO 1C03_HUMAN 1C04_GORGO
1C04_HUMAN 1C05_HUMAN 1C06_HUMAN 1C07_HUMAN
1C11_HUMAN 1C12_HUMAN 1C13_HUMAN 1C14_HUMAN
1C15_HUMAN 1C16_HUMAN 1C17_HUMAN 1C18_HUMAN
1C28_PANTR 1CXX_HUMAN 1OKO_GORGO HA10_MOUSE
HA11_MOUSE HA11_RAT HA12_MOUSE HA12_RAT
HA13_MOUSE HA14_MOUSE HA15_MOUSE HA17_MOUSE
HA18_MOUSE HA19_CANFA HA1A_BOVIN HA1A_RABIT
HA1B_BOVIN HA1B_MOUSE HA1B_RABIT HA1D_MOUSE
HA1F_CHICK HA1K_MOUSE HA1L_MOUSE HA1T_MOUSE
HA1U_MOUSE HA1W_MOUSE HFE_HUMAN HFE_MOUSE
HFE_RAT HLAE_HUMAN HLAF_HUMAN HLAF_MACMU
HLAG_HUMAN HLAH_HUMAN O02865 O02948
O15506 O19075 O19240 O19241
O19242 O19243 O19244 O19245
O19440 O19441 O19442 O19443
O19445 O19446 O19478 O19480
O19481 O19554 O19617 O19755
O19756 O19790 O35641 O46684
O46705 O46706 O46788 O46789
O46790 O46791 O46792 O46817
O46818 O46819 O46820 O46821
O46822 O46823 O46824 O46825
O46826 O46827 O46828 O46829
O46830 O46831 O46832 O46833
O46834 O46835 O46836 O46837
O46838 O46839 O46840 O46841
O46842 O46843 O46844 O46845
O46846 O46847 O46848 O46849
O46880 O46881 O46882 O46885
O46886 O60386 O62881 O62894
O62895 O62896 O73901 O73904
O75929 O77949 O77950 O77972
O77973 O77974 O77975 O77976
O77977 O78083 O78105 O78126
O78165 O78172 O78173 O78178
O78179 O78180 O78186 O78189
O78211 O78214 O78218 O97982
O97985 O97986 O98028 O98032
O98187 O98188 O98189 O98191
O98192 O98193 O98272 P70466
P79458 P79489 P79490 P79496
P79498 P79523 P79524 P79549
P79555 P79563 P79567 P79568
P79570 P79587 P79588 P79589
P79603 P79612 Q05081 Q08173
Q08546 Q08680 Q29633 Q29637
Q29638 Q29641 Q29644 Q29652
Q29661 Q29669 Q29681 Q29689
Q29693 Q29697 Q29700 Q29705
Q29718 Q29747 Q29748 Q29749
Q29757 Q29767 Q29836 Q29840
Q29842 Q29844 Q29845 Q29846
Q29847 Q29848 Q29849 Q29850
Q29852 Q29854 Q29855 Q29857
Q29858 Q29861 Q29862 Q29864
Q29865 Q29907 Q29911 Q29921
Q29924 Q29925 Q29932 Q29935
Q29938 Q29940 Q29941 Q29943
Q29959 Q29960 Q29961 Q29963
Q29981 Q29982 Q29985 Q29988
Q29991 Q29992 Q29993 Q30171
Q30172 Q30173 Q30182 Q30192
Q30287 Q30289 Q30290 Q30291
Q30428 Q30481 Q30482 Q30483
Q30484 Q30485 Q30486 Q30488
Q30493 Q30591 Q30592 Q30593
Q30595 Q30711 Q30712 Q30713
Q30714 Q30715 Q30716 Q30718
Q30719 Q30720 Q30721 Q30768
Q30838 Q30849 Q30868 Q30869
Q30870 Q30871 Q30900 Q30901
Q30988 Q31066 Q31067 Q31068
Q31069 Q31093 Q31129 Q31141
Q31142 Q31148 Q31149 Q31153
Q31155 Q31166 Q31169 Q31170
Q31172 Q31173 Q31188 Q31191
Q31196 Q31202 Q31204 Q31206
Q31208 Q31214 Q31215 Q31216
Q31218 Q31246 Q31254 Q31255
Q31256 Q31266 Q31267 Q31271
Q31277 Q31365 Q31387 Q31400
Q31499 Q31594 Q31602 Q31603
Q31605 Q31610 Q31612 Q31613
Q31614 Q31615 Q31627 Q31634
Q60678 Q61642 Q61891 Q61892
Q61893 Q61894 Q61895 Q61896
Q62585 Q62708 Q64272 Q95343
Q95365 Q95377 Q95393 Q95394
Q95395 Q95457 Q95458 Q95460
Q95463 Q95477 Q95479 Q95480
Q95481 Q95482 Q95483 Q95486
Q95487 Q95551 Q95557 Q95558
Q95559 Q95560 Q95577 Q95592
Q95601 Q95603 Q95604 Q9BCM6
Q9BCM7 Q9BCN0 Q9BCN1 Q9BCU2
Q9BCU3 Q9BCU4 Q9BCW3 Q9BCY4
Q9BCY5 Q9BCY6 Q9BCY7 Q9BCY8
Q9BCY9 Q9BCZ0 Q9BCZ1 Q9BD06
Q9BD49 Q9BD50 Q9BD51 Q9BD52
Q9BD53 Q9D754 Q9DBB7 Q9GIJ3
Q9GIK4 Q9GIK8 Q9GIL3 Q9GIP6
Q9GIW5 Q9GIW6 Q9GIW7 Q9GIX2
Q9GIY5 Q9GIY7 Q9GIY8 Q9GIZ0
Q9GJ44 Q9GJ45 Q9GJ78 Q9GJB8
Q9GJB9 Q9GJC0 Q9GJC1 Q9GJC2
Q9GJE3 Q9GJE4 Q9GKZ0 Q9GL41
Q9GL42 Q9GL43 Q9JHM2 Q9JHN3
Q9JHN4 Q9JHN5 Q9JHN6 Q9JHN7
Q9MW42 Q9MWK4 Q9MX28 Q9MX69
Q9MXC6 Q9MXC7 Q9MXC8 Q9MXC9
Q9MXD0 Q9MXD1 Q9MXD2 Q9MXG3
Q9MXG5 Q9MXG6 Q9MXH0 Q9MXH1
Q9MXH2 Q9MXH3 Q9MXH4 Q9MXH5
Q9MXH6 Q9MXH7 Q9MXH8 Q9MXH9
Q9MXI0 Q9MXI1 Q9MXI2 Q9MXI3
Q9MXI6 Q9MXI8 Q9MXJ2 Q9MXJ9
Q9MXK0 Q9MXK1 Q9MXK3 Q9MXK4
Q9MXK5 Q9MXK6 Q9MXK7 Q9MXK9
Q9MXL0 Q9MXL4 Q9MXL6 Q9MXL7
Q9MXL8 Q9MXL9 Q9MXM0 Q9MXM1
Q9MXM2 Q9MXM3 Q9MXM4 Q9MXM5
Q9MXM6 Q9MXM7 Q9MXQ3 Q9MXR5
Q9MXS3 Q9MXS4 Q9MXS5 Q9MY33
Q9MY34 Q9MY52 Q9MY72 Q9MYA2
Q9MYB7 Q9MYB8 Q9MYC0 Q9MYC3
Q9MYG4 Q9MYG5 Q9MYI5 Q9MYI6
Q9NPL2 Q9QYQ4 Q9QYV4 Q9TNN4
Q9TNN7 Q9TNN8 Q9TNR0 Q9TNR1
Q9TNR2 Q9TNR3 Q9TNR4 Q9TNW9
Q9TNX1 Q9TNZ1 Q9TNZ2 Q9TNZ3
Q9TP04 Q9TP68 Q9TP69 Q9TP95
Q9TP98 Q9TP99 Q9TPA0 Q9TPA1
Q9TPA2 Q9TPA3 Q9TPA4 Q9TPA5
Q9TPA6 Q9TPA7 Q9TPK7 Q9TPL0
Q9TPL2 Q9TPL3 Q9TPL4 Q9TPL5
Q9TPL6 Q9TPL7 Q9TPW6 Q9TPX2
Q9TQ65 Q9TQ73 Q9TQ74 Q9TQ85
Q9TQB1 Q9TQB6 Q9TQB9 Q9TQD4
Q9TQD5 Q9TQP6 Q9TQP7 Q9TQP9
Q9TSW1 Q9TSW2 Q9TSW3 Q9TSW4
Q9TSW5 Q9TSW6 Q9UIN2 Q9UIP6
Q9UQS8 Q9UQS9 Q9XR30 Q9XR31
Q9XRX0 Q9XRX9 Q9XRY2 Q9XRY3
ZA2G_HUMAN ZA2G_MOUSE ZA2G_RAT
True Positive Partials
Codes involving 3 elements
O19479 O19633 O46704 O75930
O75931 O95733 Q31062 Q31205
Q62143 Q9CZ20 Q9GIL2 Q9R105
Q9TNS9
Codes involving 2 elements
Q30717 Q31599 Q61640 Q9HC83
Sequence Titles
1A01_GORGO  Class I histocompatibility antigen, GOGO-A0101 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla). 
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor - Homo sapiens (Human).
1A01_PANTR CHLA class I histocompatibility antigen, A-2 alpha chain precursor - Pan troglodytes (Chimpanzee).
1A01_PONPY Class I histocompatibility antigen, A-1 alpha chain precursor - Pongo pygmaeus (Orangutan).
1A01_SAGOE Class I histocompatibility antigen, A alpha chain precursor - Saguinus oedipus (Cotton-top tamarin).
1A02_GORGO Class I histocompatibility antigen, GOGO-A0201 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha chain precursor - Homo sapiens (Human).
1A02_PANTR CHLA class I histocompatibility antigen, A-5 alpha chain precursor - Pan troglodytes (Chimpanzee).
1A03_GORGO Class I histocompatibility antigen, GOGO-A0401 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha chain precursor - Homo sapiens (Human).
1A03_PANTR CHLA class I histocompatibility antigen, A-108 alpha chain precursor - Pan troglodytes (Chimpanzee).
1A04_GORGO Class I histocompatibility antigen, GOGO-A0501 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1A04_PANTR CHLA class I histocompatibility antigen, A-126 alpha chain precursor - Pan troglodytes (Chimpanzee).
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor - Homo sapiens (Human).
1A23_HUMAN HLA class I histocompatibility antigen, A-23(A-9) alpha chain precursor - Homo sapiens (Human).
1A24_HUMAN HLA class I histocompatibility antigen, A-24(A-9) alpha chain precursor (AW-24) - Homo sapiens (Human).
1A25_HUMAN HLA class I histocompatibility antigen, A-25(A-10) alpha chain precursor - Homo sapiens (Human).
1A26_HUMAN HLA class I histocompatibility antigen, A-26(A-10) alpha chain precursor - Homo sapiens (Human).
1A29_HUMAN HLA class I histocompatibility antigen, A-29 alpha chain precursor (AW-19) - Homo sapiens (Human).
1A30_HUMAN HLA class I histocompatibility antigen, A-30(AW-19) alpha chain precursor - Homo sapiens (Human).
1A31_HUMAN HLA class I histocompatibility antigen, A-31 alpha chain precursor (Aw-19) - Homo sapiens (Human).
1A32_HUMAN HLA class I histocompatibility antigen, A-32(AW-19) alpha chain precursor - Homo sapiens (Human).
1A33_HUMAN HLA class I histocompatibility antigen, AW-33(AW-19) alpha chain precursor - Homo sapiens (Human).
1A34_HUMAN HLA class I histocompatibility antigen, AW-34(A-10) alpha chain precursor - Homo sapiens (Human).
1A36_HUMAN HLA class I histocompatibility antigen, AW-36 alpha chain precursor - Homo sapiens (Human).
1A43_HUMAN HLA class I histocompatibility antigen, AW-43 alpha chain precursor - Homo sapiens (Human).
1A66_HUMAN HLA class I histocompatibility antigen, A-66 alpha chain precursor (Aw-66) (A-10) - Homo sapiens (Human).
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha chain precursor (Aw-68) (A-28) - Homo sapiens (Human).
1A74_HUMAN HLA class I histocompatibility antigen, A-74 alpha chain precursor (Aw-74) (Aw-19) - Homo sapiens (Human).
1A80_HUMAN HLA class I histocompatibility antigen, AW-80(A-1) alpha chain precursor - Homo sapiens (Human).
1B01_GORGO Class I histocompatibility antigen, GOGO-B0101 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1B01_SAGOE Class I histocompatibility antigen, B alpha chain precursor - Saguinus oedipus (Cotton-top tamarin).
1B02_GORGO Class I histocompatibility antigen, GOGO-B0102 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1B02_HUMAN HLA class I histocompatibility antigen, B-7 B*0702 alpha chain precursor (B7.2) - Homo sapiens (Human).
1B02_PANTR CHLA class I histocompatibility antigen, B-2 alpha chain precursor - Pan troglodytes (Chimpanzee).
1B03_GORGO Class I histocompatibility antigen, GOGO-B0103 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1B04_GORGO Class I histocompatibility antigen, GOGO-B0201 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1B04_HUMAN HLA class I histocompatibility antigen, B-8 B*0801 alpha chain precursor - Homo sapiens (Human).
1B05_HUMAN HLA class I histocompatibility antigen, B-13 B*1301 alpha chain precursor (B13.1) - Homo sapiens (Human).
1B07_HUMAN HLA class I histocompatibility antigen, B-14 B*1401 alpha chain precursor - Homo sapiens (Human).
1B08_HUMAN HLA class I histocompatibility antigen, BW-65(B-14) B*1402 alpha chain precursor - Homo sapiens (Human).
1B10_HUMAN HLA class I histocompatibility antigen, BW-75(B-15) B*1502 alpha chain precursor - Homo sapiens (Human).
1B11_HUMAN HLA class I histocompatibility antigen, BW-72(BW-70) B*1503 alpha chain precursor - Homo sapiens (Human).
1B12_HUMAN HLA class I histocompatibility antigen, B-62 B*1504 alpha chain precursor - Homo sapiens (Human).
1B13_HUMAN HLA class I histocompatibility antigen, B-18 B*1801 alpha chain precursor - Homo sapiens (Human).
1B14_HUMAN HLA class I histocompatibility antigen, B-27 alpha chain precursor - Homo sapiens (Human).
1B15_HUMAN HLA class I histocompatibility antigen, B-27 B*2702 alpha chain precursor (B-27K) (B27.2) - Homo sapiens (Human).
1B16_HUMAN HLA class I histocompatibility antigen, B-27 B*2703 alpha chain precursor (B-27D) - Homo sapiens (Human).
1B18_HUMAN HLA class I histocompatibility antigen, B-27 B*2705 alpha chain precursor (B-27W) (B27.1) - Homo sapiens (Human).
1B19_HUMAN HLA class I histocompatibility antigen, B-27 B*2706 alpha chain precursor - Homo sapiens (Human).
1B20_HUMAN HLA class I histocompatibility antigen, B-27 B*2707 alpha chain (B27-HS) - Homo sapiens (Human).
1B21_HUMAN HLA class I histocompatibility antigen, B-35 B*3501 alpha chain precursor - Homo sapiens (Human).
1B22_HUMAN HLA class I histocompatibility antigen, B-35 B*3502 alpha chain precursor - Homo sapiens (Human).
1B23_HUMAN HLA class I histocompatibility antigen, B-35 B*3503 alpha chain precursor - Homo sapiens (Human).
1B25_HUMAN HLA class I histocompatibility antigen, B-35 B*3505 alpha chain precursor (B35-G) - Homo sapiens (Human).
1B26_HUMAN HLA class I histocompatibility antigen, B-35 B*3506 alpha chain precursor (B35-K) - Homo sapiens (Human).
1B27_HUMAN HLA class I histocompatibility antigen, B-35 B*3507 alpha chain precursor - Homo sapiens (Human).
1B28_HUMAN HLA class I histocompatibility antigen, B-35 B*3508 alpha chain precursor - Homo sapiens (Human).
1B29_HUMAN HLA class I histocompatibility antigen, B-37 B*3701 alpha chain precursor - Homo sapiens (Human).
1B31_HUMAN HLA class I histocompatibility antigen, B-39 B*3901 alpha chain precursor (B39.1) - Homo sapiens (Human).
1B32_HUMAN HLA class I histocompatibility antigen, B-39 B*3902 alpha chain precursor (B39.2) - Homo sapiens (Human).
1B34_HUMAN HLA class I histocompatibility antigen, B-40 B*4002 alpha chain precursor - Homo sapiens (Human).
1B35_HUMAN HLA class I histocompatibility antigen, B-40 B*4003 alpha chain precursor (B40-G1) - Homo sapiens (Human).
1B36_HUMAN HLA class I histocompatibility antigen, B-40 B*4004 alpha chain precursor (B40-G2) - Homo sapiens (Human).
1B38_HUMAN HLA class I histocompatibility antigen, BW-41 B*4101 alpha chain precursor - Homo sapiens (Human).
1B39_HUMAN HLA class I histocompatibility antigen, BW-42 B*4201 alpha chain precursor - Homo sapiens (Human).
1B41_HUMAN HLA class I histocompatibility antigen, BW-44(B-12) B*4402 alpha chain precursor (B44.2) - Homo sapiens (Human).
1B42_HUMAN HLA class I histocompatibility antigen, BW-44(B-12) B*4403 alpha chain precursor - Homo sapiens (Human).
1B43_HUMAN HLA class I histocompatibility antigen, BW-45(B-12) B*4501 alpha chain precursor - Homo sapiens (Human).
1B44_HUMAN HLA class I histocompatibility antigen, BW-46 B*4601 alpha chain precursor - Homo sapiens (Human).
1B45_HUMAN HLA class I histocompatibility antigen, BW-47 B*4701 alpha chain precursor - Homo sapiens (Human).
1B46_HUMAN HLA class I histocompatibility antigen, B-48 B*4801 alpha chain precursor - Homo sapiens (Human).
1B47_HUMAN HLA class I histocompatibility antigen, B-49(B-21) B*4901 alpha chain precursor - Homo sapiens (Human).
1B48_HUMAN HLA class I histocompatibility antigen, BW-50(B-21) B*5001 alpha chain precursor - Homo sapiens (Human).
1B49_HUMAN HLA class I histocompatibility antigen, B-51(B-5) B*5101 alpha chain precursor - Homo sapiens (Human).
1B52_HUMAN HLA class I histocompatibility antigen, B-51(B-5) B*5104 alpha chain precursor - Homo sapiens (Human).
1B53_HUMAN HLA class I histocompatibility antigen, BW-52(B-5) B*5201 alpha chain precursor - Homo sapiens (Human).
1B54_HUMAN HLA class I histocompatibility antigen, BW-53 B*5301 alpha chain precursor - Homo sapiens (Human).
1B55_HUMAN HLA class I histocompatibility antigen, BW-54(BW-22) B*5401 alpha chain precursor - Homo sapiens (Human).
1B56_HUMAN HLA class I histocompatibility antigen, BW-55(BW-22) B*5501 alpha chain precursor - Homo sapiens (Human).
1B57_HUMAN HLA class I histocompatibility antigen, BW-55(BW-22) B*5502 alpha chain precursor - Homo sapiens (Human).
1B58_HUMAN HLA class I histocompatibility antigen, BW-56(BW-22) B*5601 alpha chain precursor - Homo sapiens (Human).
1B59_HUMAN HLA class I histocompatibility antigen, BW-56(BW-22) B*5602 alpha chain precursor - Homo sapiens (Human).
1B60_HUMAN HLA class I histocompatibility antigen, B-57(B-17) B*5701 alpha chain precursor (BW57.1) - Homo sapiens (Human).
1B61_HUMAN HLA class I histocompatibility antigen, B-57(B-17) B*5702 alpha chain precursor (BW57.2) - Homo sapiens (Human).
1B62_HUMAN HLA class I histocompatibility antigen, BW-58(B-17) B*5801 alpha chain precursor - Homo sapiens (Human).
1B63_HUMAN HLA class I histocompatibility antigen, BW-78 B*7801 alpha chain precursor - Homo sapiens (Human).
1C01_GORGO Class I histocompatibility antigen, GOGO-C0101/C0102 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1C01_HUMAN HLA class I histocompatibility antigen, CW-1 CW*0101 alpha chain precursor (CW1.1) - Homo sapiens (Human).
1C01_PANTR CHLA class I histocompatibility antigen, C alpha chain precursor - Pan troglodytes (Chimpanzee).
1C01_SAGOE Class I histocompatibility antigen, C alpha chain precursor - Saguinus oedipus (Cotton-top tamarin).
1C02_GORGO Class I histocompatibility antigen, GOGO-C0201 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1C02_HUMAN HLA class I histocompatibility antigen, CW-1 CW*0102 alpha chain precursor (CW1.2) - Homo sapiens (Human).
1C03_GORGO Class I histocompatibility antigen, GOGO-C0202 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1C03_HUMAN HLA class I histocompatibility antigen, CW-2 CW*0201 alpha chain precursor (CW2.1) - Homo sapiens (Human).
1C04_GORGO Class I histocompatibility antigen, GOGO-C0203 alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
1C04_HUMAN HLA class I histocompatibility antigen, CW-2 CW*0202 alpha chain precursor (CW2.2) - Homo sapiens (Human).
1C05_HUMAN HLA class I histocompatibility antigen, CW-3 CW*0301 alpha chain precursor (CW3.1) - Homo sapiens (Human).
1C06_HUMAN HLA class I histocompatibility antigen, CW-3 CW*0302 alpha chain precursor (CW3.2) - Homo sapiens (Human).
1C07_HUMAN HLA class I histocompatibility antigen, CW-4 CW*0401 alpha chain precursor (PL208) - Homo sapiens (Human).
1C11_HUMAN HLA class I histocompatibility antigen, CW-7 CW*0704 alpha chain precursor - Homo sapiens (Human).
1C12_HUMAN HLA class I histocompatibility antigen, CW-8 CW*0801 alpha chain precursor (CW8.1) - Homo sapiens (Human).
1C13_HUMAN HLA class I histocompatibility antigen, CW-8 CW*0802 alpha chain precursor (CW8.2) - Homo sapiens (Human).
1C14_HUMAN HLA class I histocompatibility antigen, CW-8 CW*0803 alpha chain precursor - Homo sapiens (Human).
1C15_HUMAN HLA class I histocompatibility antigen, CW*1201 alpha chain precursor (HLA-CX52) - Homo sapiens (Human).
1C16_HUMAN HLA class I histocompatibility antigen, CW*1202 alpha chain precursor (HLA-CB-2) (CW*0602) (CW6) - Homo sapiens (Human).
1C17_HUMAN HLA class I histocompatibility antigen, CW*1401 alpha chain precursor (HLA-CB-1) - Homo sapiens (Human).
1C18_HUMAN HLA class I histocompatibility antigen, CW-2 CW*1502 alpha chain precursor - Homo sapiens (Human).
1C28_PANTR CHLA class I histocompatibility antigen, CH28 alpha chain precursor - Pan troglodytes (Chimpanzee).
1CXX_HUMAN HLA class I histocompatibility antigen, C-4 alpha chain - Homo sapiens (Human).
1OKO_GORGO Class I histocompatibility antigen, GOGO-OKO alpha chain precursor - Gorilla gorilla gorilla (Lowland gorilla).
HA10_MOUSE H-2 class I histocompatibility antigen, Q10 alpha chain precursor - Mus musculus (Mouse).
HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain precursor (H-2D(B)) - Mus musculus (Mouse).
HA11_RAT Class I histocompatibility antigen, NON-RT1.A alpha-1 chain precursor - Rattus norvegicus (Rat).
HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain precursor (H-2D(D)) - Mus musculus (Mouse).
HA12_RAT RT1 class I histocompatibility antigen, AA alpha chain precursor - Rattus norvegicus (Rat).
HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain precursor (H-2D(K)) - Mus musculus (Mouse).
HA14_MOUSE H-2 class I histocompatibility antigen, D-P alpha chain precursor (H-2D(P)) - Mus musculus (Mouse).
HA15_MOUSE H-2 class I histocompatibility antigen, D-37 alpha chain precursor - Mus musculus (Mouse).
HA17_MOUSE H-2 class I histocompatibility antigen, Q7 alpha chain precursor (QA-2 antigen) - Mus musculus (Mouse).
HA18_MOUSE H-2 class I histocompatibility antigen, Q8 alpha chain precursor - Mus musculus (Mouse).
HA19_CANFA DLA class I histocompatibility antigen, A9/A9 alpha chain precursor - Canis familiaris (Dog).
HA1A_BOVIN BOLA class I histocompatibility antigen, alpha chain BL3-6 precursor - Bos taurus (Bovine).
HA1A_RABIT RLA class I histocompatibility antigen, alpha chain 11/11 precursor - Oryctolagus cuniculus (Rabbit).
HA1B_BOVIN BOLA class I histocompatibility antigen, alpha chain BL3-7 precursor - Bos taurus (Bovine).
HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain precursor (H-2K(B)) - Mus musculus (Mouse).
HA1B_RABIT RLA class I histocompatibility antigen, alpha chain 19-1 precursor - Oryctolagus cuniculus (Rabbit).
HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain precursor (H-2K(D)) - Mus musculus (Mouse).
HA1F_CHICK Class I histocompatibility antigen, F10 alpha chain precursor (B-F histocompatibility F10 antigen) (B-F-beta-IV) (B12) - Gallus gallus (Chicken).
HA1K_MOUSE H-2 class I histocompatibility antigen, K-K alpha chain precursor (H-2K(K)) - Mus musculus (Mouse).
HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain precursor - Mus musculus (Mouse).
HA1T_MOUSE H-2 class I histocompatibility antigen, TLA(B) alpha chain precursor (MHC thymus leukemia antigen) - Mus musculus (Mouse).
HA1U_MOUSE H-2 class I histocompatibility antigen, TLA(C) alpha chain precursor - Mus musculus (Mouse).
HA1W_MOUSE H-2 class I histocompatibility antigen, K-W28 alpha chain precursor - Mus musculus (Mouse).
HFE_HUMAN Hereditary haemochromatosis protein precursor (HLA-H) - Homo sapiens (Human).
HFE_MOUSE Hereditary haemochromatosis protein homolog precursor - Mus musculus (Mouse).
HFE_RAT Hereditary haemochromatosis protein homolog precursor (RT1-CAFE) - Rattus norvegicus (Rat).
HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E*0101/E*0102 precursor - Homo sapiens (Human).
HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F precursor (HLA F antigen) (Leukocyte antigen F) (CDA12) - Homo sapiens (Human).
HLAF_MACMU HLA class I histocompatibility antigen, alpha chain F precursor (HLA F antigen) (Leukocyte antigen F) - Macaca mulatta (Rhesus macaque).
HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G precursor (HLA G antigen) - Homo sapiens (Human).
HLAH_HUMAN HLA class I histocompatibility antigen, alpha chain H precursor (HLA-AR) (HLA-12.4) - Homo sapiens (Human).
O02865 HLA-CW*0103 - Homo sapiens (Human).
O02948 MHC CLASS I ANTIGEN - Macaca mulatta (Rhesus macaque).
O15506 HUMAN LEUKOCYTE ANTIGEN PRECURSOR - Homo sapiens (Human).
O19075 LEUCOCYTE ANTIGEN - Sus scrofa (Pig).
O19240 MHC CLASS I ANTIGEN - Sus scrofa (Pig).
O19241 MHC CLASS I ANTIGEN - Sus scrofa (Pig).
O19242 MHC CLASS I ANTIGEN - Sus scrofa (Pig).
O19243 MHC CLASS I ANTIGEN - Sus scrofa (Pig).
O19244 MHC CLASS I ANTIGEN - Sus scrofa (Pig).
O19245 MHC CLASS I ANTIGEN - Sus scrofa (Pig).
O19440 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I B - Mus musculus (Mouse).
O19441 HISTOCOMPATIBILITY 2, Q REGION LOCUS 1 (MAJOR HISTOCOMPABILITY COMPLEX Q1B) - Mus musculus (Mouse).
O19442 HISTOCOMPATIBILITY 2, M REGION LOCUS 9 (MHC CLASS IB ANTIGEN) - Mus musculus (Mouse).
O19443 HISTOCOMPATIBILITY 2, M REGION LOCUS 10.1 (MHC CLASS IB ANTIGEN) - Mus musculus (Mouse).
O19445 MHC CLASS IB ANTIGEN - Rattus norvegicus (Rat).
O19446 MHC CLASS IA PROTEIN - Rattus norvegicus (Rat).
O19478 HISTOCOMPATIBILITY-2 COMPLEX CLASS 1-LIKE PROTEIN (MHC CLASS I-LIKE PROTEIN) - Mus musculus (Mouse).
O19480 MHC CLASS I PROTEIN - Heterodontus francisci (Horn shark).
O19481 MHC CLASS I PROTEIN - Heterodontus francisci (Horn shark).
O19554 MHC CLASS I ANTIGEN - Homo sapiens (Human).
O19617 HLA CLASS I ANTIGEN - Homo sapiens (Human).
O19755 MHC CLASS I ANTIGEN HLA-B35 - Homo sapiens (Human).
O19756 MHC CLASS I HLA-A - Homo sapiens (Human).
O19790 MHC CLASS I ANTIGEN HLA-B - Homo sapiens (Human).
O35641 H-2K(D) ANTIGEN - Mus musculus (Mouse).
O46684 PATR-C*0901 - Pan troglodytes (Chimpanzee), and Pan paniscus (Pygmy chimpanzee) (Bonobo).
O46705 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I PROTEIN - Fugu rubripes (Japanese pufferfish) (Takifugu rubripes).
O46706 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I PROTEIN - Fugu rubripes (Japanese pufferfish) (Takifugu rubripes).
O46788 MHC CLASS I GLYCOPROTEIN - Gallus gallus (Chicken).
O46789 MHC CLASS I GLYCOPROTEIN - Gallus gallus (Chicken).
O46790 MHC CLASS I GLYCOPROTEIN - Gallus gallus (Chicken).
O46791 MHC CLASS I GLYCOPROTEIN - Gallus gallus (Chicken).
O46792 MHC CLASS I GLYCOPROTEIN - Gallus gallus (Chicken).
O46817 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46818 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46819 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46820 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46821 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46822 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46823 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46824 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46825 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46826 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46827 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46828 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46829 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46830 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46831 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46832 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46833 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46834 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46835 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46836 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46837 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46838 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46839 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46840 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46841 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46842 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46843 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46844 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46845 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46846 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46847 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46848 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46849 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46880 MHC CLASS I DLA-12 - Canis familiaris (Dog).
O46881 MHC CLASS I DLA-64 - Canis familiaris (Dog).
O46882 MHC CLASS I DLA-88 - Canis familiaris (Dog).
O46885 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O46886 MHC CLASS I ANTIGEN - Triakis scyllium (Leopard shark) (Triakis scyllia).
O60386 ZN-ALPHA2-GLYCOPROTEIN - Homo sapiens (Human).
O62881 MHC CLASS I HEAVY CHAIN - Grus canadensis pratensis (Florida sandhill crane).
O62894 MHC CLASS I ALPHA CHAIN - Ictalurus punctatus (Channel catfish).
O62895 MHC CLASS I ALPHA CHAIN - Ictalurus punctatus (Channel catfish).
O62896 MHC CLASS I ALPHA CHAIN - Ictalurus punctatus (Channel catfish).
O73901 B LOCUS F ALPHA CHAIN 2 - Gallus gallus (Chicken).
O73904 B LOCUS F ALPHA CHAIN 1 - Gallus gallus (Chicken).
O75929 HEMOCHROMATOSIS SPLICE VARIANT DEL14E4 - Homo sapiens (Human).
O77949 MHC CLASS I ANTIGEN - Rattus norvegicus (Rat).
O77950 MHC CLASS I ANTIGEN - Rattus norvegicus (Rat).
O77972 MHC CLASS I ANTIGEN PRECURSOR - Bos taurus (Bovine).
O77973 MHC CLASS I ANTIGEN PRECURSOR - Bos taurus (Bovine).
O77974 MHC CLASS I ANTIGEN PRECURSOR - Bos taurus (Bovine).
O77975 MHC CLASS I ANTIGEN PRECURSOR - Bos taurus (Bovine).
O77976 MHC CLASS I ANTIGEN PRECURSOR - Bos taurus (Bovine).
O77977 MHC CLASS I ANTIGEN PRECURSOR - Bos taurus (Bovine).
O78083 HLA-CW0702 - Homo sapiens (Human).
O78105 MHC CLASS IB RT1.S3 PRECURSOR - Rattus norvegicus (Rat).
O78126 MHC CLASS I HLA-A - Homo sapiens (Human).
O78165 MHC CLASS I ANTIGEN - Homo sapiens (Human).
O78172 HLA-B ALPHA CHAIN (B*5002) PRECURSOR (B*5002) - Homo sapiens (Human).
O78173 HLA-B ALPHA CHAIN (B*5108) PRECURSOR (B*5108) - Homo sapiens (Human).
O78178 MHC CLASS I ANTIGEN - Homo sapiens (Human).
O78179 MHC CLASS I ANTIGEN (MAJOR HISTOCOMPATIBILITY COMPLEX, CLASS I, C) - Homo sapiens (Human).
O78180 HLA CLASS I ANTIGEN HLA-B - Homo sapiens (Human).
O78186 MHC CLASS I ANTIGEN PRECURSOR - Bos taurus (Bovine).
O78189 MHC CLASS I ANTIGEN - Homo sapiens (Human).
O78211 HUMAN LEUKOCYTE ANTIGEN-C ALPHA CHAIN PRECURSOR - Homo sapiens (Human).
O78214 HUMAN LEUKOCYTE ANTIGEN-CW*1205 PRECURSOR - Homo sapiens (Human).
O78218 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
O97982 MHC CLASS I ANTIGEN - Cyprinus carpio (Common carp).
O97985 MHC CLASS I RELATED PROTEIN 1 ISOFORM B (MHC CLASS I RELATED PROTEIN, MR1B2 ISOFORM) - Homo sapiens (Human), and Pan troglodytes (Chimpanzee).
O97986 MHC CLASS I RELATED PROTEIN 1 ISOFORM C - Homo sapiens (Human).
O98028 MHC CLASS I - Diceros bicornis minor.
O98032 MHC CLASS IB ANTIGEN QA-1C - Mus musculus (Mouse).
O98187 MHC CLASS I ANTIGEN - Acrocephalus arundinaceus (great reed warbler).
O98188 MHC CLASS I ANTIGEN - Acrocephalus arundinaceus (great reed warbler).
O98189 MHC CLASS I ANTIGEN - Acrocephalus arundinaceus (great reed warbler).
O98191 MHC CLASS I ANTIGEN - Acrocephalus arundinaceus (great reed warbler).
O98192 MHC CLASS I ANTIGEN - Acrocephalus arundinaceus (great reed warbler).
O98193 MHC CLASS I ANTIGEN - Acrocephalus arundinaceus (great reed warbler).
O98272 MHC CLASS I PRECURSOR - Gadus morhua (Atlantic cod).
P70466 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN - Peromyscus maniculatus (Deer mouse).
P79458 MHC CLASS IA ALPHA CHAIN - Ambystoma mexicanum (Axolotl).
P79489 HLA-B55.2 - Homo sapiens (Human).
P79490 HLA-B22N - Homo sapiens (Human).
P79496 HLA-B ALPHA CHAIN (B*5703GB) PRECURSOR (B*5703GB) - Homo sapiens (Human).
P79498 HLA-C ALPHA CHAIN FOR CW*18GB PRECURSOR - Homo sapiens (Human).
P79523 MHC CLASS I HISTOCOMPATIBILITY ANTIGEN HLA-B - Homo sapiens (Human).
P79524 MHC CLASS I HLA-B44BO - Homo sapiens (Human).
P79549 MHC CLASS I ANTIGEN - Homo sapiens (Human).
P79555 MHC CLASS I ANTIGEN - Homo sapiens (Human).
P79563 HLA-A26 - Homo sapiens (Human).
P79567 CLASS IB MHC ANTIGEN QA-2 PRECURSOR - Mus musculus (Mouse).
P79568 CLASS IB MHC ANTIGEN QA-2 - Mus musculus (Mouse).
P79570 MHC CLASS I PRECURSOR - Oncorhynchus gorbuscha (Pink salmon) (Humpback salmon).
P79587 CLASS I MHC HEAVY CHAIN RT1.A(N) ANTIGEN PRECURSOR - Rattus norvegicus (Rat).
P79588 CLASS I MHC HEAVY CHAIN RT1.A(N) ANTIGEN PRECURSOR - Rattus norvegicus (Rat).
P79589 CLASS I MHC HEAVY CHAIN RT1.A(N) ANTIGEN PRECURSOR - Rattus norvegicus (Rat).
P79603 MHC CLASS I HLA-A PROTEIN - Homo sapiens (Human).
P79612 HLA-B PROTEIN - Homo sapiens (Human).
Q05081 11/3R CLASS I HISTOCOMPATABILITY ANTIGEN - Rattus norvegicus (Rat).
Q08173 HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-71 ALPHA CHAIN - Homo sapiens (Human).
Q08546 CLASS I HISTOCOMPATIBILITY ANTIGEN - Xenopus laevis (African clawed frog).
Q08680 RT1 CLASS I HISTOCOMPATIBILITY ANTIGEN, LW2 ALPHA CHAIN - Rattus norvegicus (Rat).
Q29633 CELL LINE GEE018 (HLA B-1519) - Homo sapiens (Human).
Q29637 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q29638 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q29641 MHC CLASS I HISTOCOMPATIBILITY ANTIGEN - Homo sapiens (Human).
Q29644 MHC CLASS I HLA-B (HLA-B-1520 ALLELE) - Homo sapiens (Human).
Q29652 HLA-CW7 - Homo sapiens (Human).
Q29661 MHC ANTIGEN HLA-B*1303 PRECURSOR - Homo sapiens (Human).
Q29669 MHC CLASS I ANTIGEN HLA-B35 - Homo sapiens (Human).
Q29681 MHC CLASS I ANTIGEN HEAVY CHAIN PRECURSOR - Homo sapiens (Human).
Q29689 MHC CLASS I ANTIGEN HLA-A2407 - Homo sapiens (Human).
Q29693 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q29697 MHC CLASS I ANTIGEN (HLA-B39) - Homo sapiens (Human).
Q29700 (HLA-B) - Homo sapiens (Human).
Q29705 MHC CLASS I ANTIGEN HLA-B PRECURSOR - Homo sapiens (Human).
Q29718 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q29747 MHC CLASS I HLA-A - Homo sapiens (Human).
Q29748 MHC CLASS I HLA-B HEAVY CHAIN - Homo sapiens (Human).
Q29749 MHC CLASS I HLA-B HEAVY CHAIN - Homo sapiens (Human).
Q29757 HYPOTHETICAL 32.0 KDA PROTEIN - Homo sapiens (Human).
Q29767 HLA-B4007 - Homo sapiens (Human).
Q29836 HLA-B-6701 - Homo sapiens (Human).
Q29840 MHC HLA-A*0301 BLANK GENE (A-,B7,DRB1*1501,DRB5, DQB1*0602), COMPLETE CDS - Homo sapiens (Human).
Q29842 HLA-B ALPHA CHAIN (MHC CLASS I ANTIGEN) - Homo sapiens (Human).
Q29844 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I - Homo sapiens (Human).
Q29845 HLA-B*1802 - Homo sapiens (Human).
Q29846 HUMAN LYMPHOCYTE ANTIGEN HLA-B27 - Homo sapiens (Human).
Q29847 MHC HLA-B39N - Homo sapiens (Human).
Q29848 HLA-B ALPHA-CHAIN - Homo sapiens (Human).
Q29849 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q29850 HLA-B ALPHA CHAIN B*4407 PRECURSOR - Homo sapiens (Human).
Q29852 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q29854 HLA-B ALPHA CHAIN ANTIGEN B7_L79 PRECURSOR - Homo sapiens (Human).
Q29855 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q29857 MAJOR HISTOCOMPATIBILITY COMPLEX HLA-B*51022 PRECURSOR - Homo sapiens (Human).
Q29858 MAJOR HISTOCOMPATIBILITY COMPLEX - Homo sapiens (Human).
Q29861 HLA-BPOT (CLASSI) - Homo sapiens (Human).
Q29862 HLA-C ALPHA CHAIN (CW*CL10V) PRECURSOR (CW*CL10V) - Homo sapiens (Human).
Q29864 HLA-C ALPHA CHAIN PRECURSOR - Homo sapiens (Human).
Q29865 HUMAN LEUKOCYTE ANTIGEN-C ALPHA CHAIN PRECURSOR - Homo sapiens (Human).
Q29907 HLA-A*2404 (HLA-A24AK) - Homo sapiens (Human).
Q29911 TRANSMEMBRANE GLYCOPROTEIN PRECURSOR - Homo sapiens (Human).
Q29921 MHC CLASS I - Homo sapiens (Human).
Q29924 MHC CLASS I HLA-B PRECURSOR - Homo sapiens (Human).
Q29925 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q29932 MHC CLASS I HLA-B*1523 PRECURSOR - Homo sapiens (Human).
Q29935 MHC CLASS I HLA-B*3802 (MHC CLASS I ANTIGEN) - Homo sapiens (Human).
Q29938 MHC CLASS I LYMPHOCYTE ANTIGEN PRECURSOR - Homo sapiens (Human).
Q29940 MHC HLA-B TRANSMEMBRANE GLYCOPROTEIN PRECURSOR - Homo sapiens (Human).
Q29941 HLA-B-1516 - Homo sapiens (Human).
Q29943 MHC CLASS I HLA-B 1515 - Homo sapiens (Human).
Q29959 MHC HLA-C-ALPHA-2 CHAIN PRECURSOR - Homo sapiens (Human).
Q29960 MHC HLA-C-ALPHA-2 CHAIN PRECURSOR - Homo sapiens (Human).
Q29961 MHC CLASS I ALPHA CHAIN PRECURSOR - Homo sapiens (Human).
Q29963 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q29981 MHC HLA-B CELL SURFACE GLYCOPROTEIN PRECURSOR - Homo sapiens (Human).
Q29982 MHC HLA-B CELL SURFACE GLYCOPROTEIN PRECURSOR - Homo sapiens (Human).
Q29985 MHC HLA-B CELL SURFACE GLYCOPROTEIN PRECURSOR - Homo sapiens (Human).
Q29988 MHC CLASS I HLA-CW3 - Homo sapiens (Human).
Q29991 HLA CLASS I HEAVY CHAIN PRECURSOR - Homo sapiens (Human).
Q29992 HLA CLASS I HEAVY CHAIN PRECURSOR - Homo sapiens (Human).
Q29993 HLA CLASS I HEAVY CHAIN PRECURSOR - Homo sapiens (Human).
Q30171 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q30172 HLA-B*1514 PRECURSOR - Homo sapiens (Human).
Q30173 LYMPHOCYTE ANTIGEN PRECURSOR - Homo sapiens (Human).
Q30182 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q30192 HLA-CW*1403 - Homo sapiens (Human).
Q30287 MHC CLASS I, HEAVY CHAIN - Bos taurus (Bovine).
Q30289 MHC CLASS 1 PRECURSOR - Bos taurus (Bovine).
Q30290 MHC CLASS 1 PRECURSOR - Bos taurus (Bovine).
Q30291 MHC CLASS 1 PRECURSOR - Bos taurus (Bovine).
Q30428 MHC CLASS IB - Canis familiaris (Dog).
Q30481 MHC CLASS I - Equus caballus (Horse).
Q30482 MHC CLASS I HEAVY CHAIN PRECURSOR - Equus caballus (Horse).
Q30483 MHC CLASS I HEAVY CHAIN PRECURSOR - Equus caballus (Horse).
Q30484 MHC CLASS I HEAVY CHAIN PRECURSOR - Equus caballus (Horse).
Q30485 MHC CLASS I HEAVY CHAIN PRECURSOR - Equus caballus (Horse).
Q30486 MHC CLASS I HEAVY CHAIN PRECURSOR - Equus caballus (Horse).
Q30488 MHC CLASS I HEAVY CHAIN PRECURSOR - Equus caballus (Horse).
Q30493 CELL SURFACE GLYCOPROTEIN - Felis silvestris catus (Cat).
Q30591 MHC CLASS I MAMU A*03 - Macaca mulatta (Rhesus macaque).
Q30592 MHC CLASS I MAMU A*04 - Macaca mulatta (Rhesus macaque).
Q30593 MHC CLASS I ANTIGEN MAMU E*05 - Macaca mulatta (Rhesus macaque).
Q30595 MHC CLASS I MAMU-B*01 - Macaca mulatta (Rhesus macaque).
Q30711 MHC CLASS I ANTIGEN MAMU B*03 - Macaca mulatta (Rhesus macaque).
Q30712 MHC CLASS I ANTIGEN MAMU B*04 - Macaca mulatta (Rhesus macaque).
Q30713 MHC CLASS I ANTIGEN MAMU B*05 - Macaca mulatta (Rhesus macaque).
Q30714 MHC CLASS I ANTIGEN MAMU B*06 - Macaca mulatta (Rhesus macaque).
Q30715 MHC CLASS I ANTIGEN MAMU B*07 - Macaca mulatta (Rhesus macaque).
Q30716 MHC CLASS I ANTIGEN MAMU B*08 - Macaca mulatta (Rhesus macaque).
Q30718 MHC CLASS I ANTIGEN MAMU A*07 - Macaca mulatta (Rhesus macaque).
Q30719 MHC CLASS I ANTIGEN MAMU B*02 - Macaca mulatta (Rhesus macaque).
Q30720 MHC CLASS I ANTIGEN MAMU A*06 - Macaca mulatta (Rhesus macaque).
Q30721 MHC CLASS I ANTIGEN MAMU B*09 - Macaca mulatta (Rhesus macaque).
Q30768 MHC CLASS I PROTEIN PRECURSOR - Macropus rufogriseus (Red-necked wallaby).
Q30838 MHC CLASS I PROTEIN PRECURSOR - Ovis aries (Sheep).
Q30849 MHC CLASS I ANTIGEN PRECURSOR - Oryctolagus cuniculus (Rabbit).
Q30868 MHC CLASS I A - Papio hamadryas (Hamadryas baboon).
Q30869 MHC CLASS I A (MHC CLASS I ANTIGEN) - Papio hamadryas (Hamadryas baboon), and Papio cynocephalus (Yellow baboon).
Q30870 MHC CLASS I A (MHC CLASS I ANTIGEN) - Papio hamadryas (Hamadryas baboon), and Papio cynocephalus (Yellow baboon).
Q30871 MHC CLASS I B - Papio hamadryas (Hamadryas baboon).
Q30900 MHC CLASS I ALPHA CHAIN PRECURSOR - Pan paniscus (Pygmy chimpanzee) (Bonobo).
Q30901 MHC CLASS I ALPHA CHAIN PRECURSOR - Pan paniscus (Pygmy chimpanzee) (Bonobo).
Q30988 CHIMPANZEE MHC CLASS I CHLA CHAIN (MHC CLASS I ANTIGEN) - Pan troglodytes (Chimpanzee).
Q31066 MHC PD1 MAJOR TRANSPLANTATION ANTIGEN - Sus scrofa (Pig).
Q31067 MHC PD1A MAJOR TRANSPLANTATION ANTIGEN - Sus scrofa (Pig).
Q31068 MHC PD14 TRANSPLANTATION ANTIGEN - Sus scrofa (Pig).
Q31069 MHC PD14A TRANSPLANTATION ANTIGEN - Sus scrofa (Pig).
Q31093 MHC CLASS I ANTIGEN H-2M3 - Mus musculus (Mouse).
Q31129 MHC CLASS I CELL SURFACE GLYCOPROTEIN - Mus musculus (Mouse).
Q31141 HISTOCOMPATIBILITY 2, K REGION (MHC H-2K ANTIGEN) - Mus musculus (Mouse).
Q31142 HISTOCOMPATIBILITY 2, K REGION (MHC H-2K ANTIGEN) - Mus musculus (Mouse).
Q31148 MHC CLASS I H2KDV1 K PRECURSOR - Mus musculus (Mouse).
Q31149 HISTOCOMPATIBILITY 2, D REGION LOCUS 1 (MHC CLASS I ALPHA CHAIN) - Mus musculus (Mouse).
Q31153 HISTOCOMPATIBILITY 2, T REGION LOCUS 23 (MHC QA-1A) (SIMILAR TO HISTOCOMPATIBILITY 2, T REGION LOCUS 23) - Mus musculus (Mouse).
Q31155 MHC CLASS I D-REGION CELL SURFACE ANTIGEN (D2D) - Mus musculus (Mouse).
Q31166 MHC INTEGRAL MEMBRANE PROTEIN M3 PRECURSOR - Mus musculus (Mouse).
Q31169 MHC CLASS I H-2DR PROTEIN PRECURSOR - Mus musculus (Mouse).
Q31170 MHC CLASS I H-2DS PROTEIN PRECURSOR - Mus musculus (Mouse).
Q31172 MHC CLASS I ANTIGEN - Mus musculus (Mouse).
Q31173 MHC H-2K-K PROTEIN - Mus musculus (Mouse).
Q31188 INTEGRAL MEMBRANE PROTEIN PRECURSOR - Mus musculus (Mouse).
Q31191 MHC CLASS I H2-K GENE - Mus musculus (Mouse).
Q31196 MHC CLASS I H2-L GENE (HAPLOTYPE D), EXONS 4-8, CLONE 27.5 - Mus musculus (Mouse).
Q31202 MHC CLASS I T13-C - Mus musculus (Mouse).
Q31204 HISTOCOMPATIBILITY 2, M REGION LOCUS 2 (MHC NONCLASSICAL CLASS I THY19.4 PROTEIN) (H-2 D HAPLOTYPE) - Mus musculus (Mouse).
Q31206 HISTOCOMPATIBILITY 2, T REGION LOCUS 10 (MHC CLASS I H2-TL-T10-129 MRNA , COMPLETE CDS) (B HAPLOTYPE) - Mus musculus (Mouse).
Q31208 HISTOCOMPATIBILITY 2, T REGION LOCUS 9 (MHC CLASS I H2-TL-T9-C MRNA , COMPLETE CDS) (D HAPLOTYPE) - Mus musculus (Mouse).
Q31214 MHC (QA) Q10-K CLASS I ANTIGEN (QA) - Mus musculus (Mouse).
Q31215 HISTOCOMPATIBILITY 2, Q REGION LOCUS 1 (CLASS I Q1-K ANTIGEN) (QA) - Mus musculus (Mouse).
Q31216 CLASS I (QA) Q5-K ANTIGEN (QA) - Mus musculus (Mouse).
Q31218 HISTOCOMPATIBILITY 2, Q REGION LOCUS 2 (CLASS I Q2K ANTIGEN) (QA) - Mus musculus (Mouse).
Q31246 MHC CLASS I PROTEIN - Mesocricetus auratus (Golden hamster).
Q31254 MHC CLASS I RT1.AB HEAVY CHAIN PRECURSOR - Rattus norvegicus (Rat).
Q31255 MHC CLASS I RT1.AC HEAVY CHAIN PRECURSOR - Rattus norvegicus (Rat).
Q31256 MHC CLASS I RT1.AU HEAVY CHAIN PRECURSOR - Rattus norvegicus (Rat).
Q31266 MHC CLASS I RT1.AW3 PROTEIN PRECURSOR - Rattus norvegicus (Rat).
Q31267 MHC CLASS I RT1.E PRECURSOR (MHC CLASS I ANTIGEN) - Rattus norvegicus (Rat).
Q31271 MHC CLASS I RT1.C-TYPE PROTEIN PRECURSOR - Rattus norvegicus (Rat).
Q31277 CELL SURFACE ANTIGEN PRECURSOR - Rattus norvegicus (Rat).
Q31365 UBA*01 CLASS I MHC MRNA - Brachydanio rerio (Zebrafish) (Zebra danio).
Q31387 MHC CLASS I PROTEIN PRECURSOR - Cyprinus carpio (Common carp).
Q31400 MAJOR CLASS I GLYCOPROTEIN PRECURSOR - Gallus gallus (Chicken).
Q31499 MAJOR HISTOCOMPATIBILITY COMPLEX-1 MHC1 PRECUSOR PRECURSOR (MHC CLASS I HEAVY CHAIN PRECURSOR) - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q31594 MHC CLASS I - Salmo salar (Atlantic salmon).
Q31602 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q31603 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q31605 ALPHA CHAIN OF MHC CLASS II PRECURSOR - Homo sapiens (Human).
Q31610 HLA-B ALPHA CHAIN B*8101 PRECURSOR (MHC CLASS I HISTOCOMPATIBILITY ANTIGEN PRECURSOR) - Homo sapiens (Human).
Q31612 MHC CLASS I HLA-B73 CHAIN PRECURSOR (MHC CLASS I ANTIGEN) - Homo sapiens (Human).
Q31613 MHC CLASS I ANTIGEN HEAVY CHAIN PRECURSOR - Homo sapiens (Human).
Q31614 MHC CLASS I H2KDV1 K PRECURSOR - Mus musculus (Mouse).
Q31615 HISTOCOMPATIBILITY 2, T REGION LOCUS 22 (MHC CLASS I H2-TL-27-B MRNA , COMPLETE CDS) (B HAPLOTYPE) - Mus musculus (Mouse).
Q31627 CLASS I MAJOR HISTOCOMPATIBILITY COMPLEX HLA-C ALPHA CHAIN PRECURSOR - Homo sapiens (Human).
Q31634 MHC CLASS I H2KDV1 K PRECURSOR - Mus musculus (Mouse).
Q60678 TL ANTIGEN PRECURSOR - Mus musculus (Mouse).
Q61642 HISTOCOMPATIBILITY 2, K REGION PRECURSOR (H-2K-SM1) - Mus musculus (Mouse).
Q61891 HISTOCOMPATIBILITY 2, D REGION LOCUS 1 (PRECURSOR) - Mus musculus (Mouse).
Q61892 HISTOCOMPATIBILITY 2, D REGION LOCUS 1 (PRECURSOR) - Mus musculus (Mouse).
Q61893 HISTOCOMPATIBILITY 2, D REGION LOCUS 1 (PRECURSOR) - Mus musculus (Mouse).
Q61894 PRECURSOR - Mus musculus (Mouse).
Q61895 PRECURSOR - Mus musculus (Mouse).
Q61896 PRECURSOR - Mus musculus (Mouse).
Q62585 NONCLASSICAL CLASS I ANTIGEN - Peromyscus maniculatus (Deer mouse).
Q62708 CLASS IB RT1 - Rattus norvegicus (Rat).
Q64272 HISTOCOMPATIBILITY 2, K REGION (PRECURSOR) - Mus musculus (Mouse).
Q95343 HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-62 B*15011 ALPHA CHAIN PRECURSOR (MHC CLASS I ANTIGEN) - Homo sapiens (Human).
Q95365 MHC CLASS I LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q95377 CELL SURFACE GLYCOPROTEIN - Homo sapiens (Human).
Q95393 MHC CLASS 1 PROTEIN MOLECULE D18.1 PRECURSOR - Bos taurus (Bovine).
Q95394 MHC CLASS 1 PROTEIN MOLECULE D18.2 PRECURSOR - Bos taurus (Bovine).
Q95395 MHC CLASS 1 PROTEIN MOLECULE D18.3 PRECURSOR - Bos taurus (Bovine).
Q95457 MHC CLASS I H-2D HEAVY CHAIN PRECURSOR - Mus musculus (Mouse).
Q95458 MHC CLASS I H-2K HEAVY CHAIN PRECURSOR - Mus musculus (Mouse).
Q95460 CLASS I HISTOCOMPATIBILITY ANTIGEN-LIKE PROTEIN - Homo sapiens (Human).
Q95463 HLA-C PROTEIN PRECURSOR - Homo sapiens (Human).
Q95477 MHC CLASS I LA-A11 ANTIGEN PRECURSOR - Bos taurus (Bovine).
Q95479 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ALPHA CHAIN PRECURSOR - Equus caballus (Horse).
Q95480 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ALPHA COMPLEX PRECURSOR - Equus caballus (Horse).
Q95481 MHC CLASS I ANTIGEN - Felis silvestris catus (Cat).
Q95482 MHC CLASS I ANTIGEN - Felis silvestris catus (Cat).
Q95483 MHC CLASS I ANTIGEN - Felis silvestris catus (Cat).
Q95486 MHC CLASS I ANTIGEN - Felis silvestris catus (Cat).
Q95487 MHC CLASS I ANTIGEN - Felis silvestris catus (Cat).
Q95551 TL ANTIGEN PRECURSOR - Mus musculus (Mouse).
Q95557 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN - Peromyscus maniculatus (Deer mouse).
Q95558 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN - Peromyscus maniculatus (Deer mouse).
Q95559 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN - Peromyscus maniculatus (Deer mouse).
Q95560 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN - Peromyscus maniculatus (Deer mouse).
Q95577 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I - Rattus norvegicus (Rat).
Q95592 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I MOLECULE - Coturnix coturnix japonica (Japanese quail).
Q95601 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I GLYCOPROTEIN HAPLOTYPE B21 - Gallus gallus (Chicken).
Q95603 HLA-CW*0702 (HUMAN LEUCOCYTE ANTIGEN C) - Homo sapiens (Human).
Q95604 HUMAN LEUKOCYTE ANTIGEN-C ALPHA CHAIN PRECURSOR - Homo sapiens (Human).
Q9BCM6 MHC CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9BCM7 MHC CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9BCN0 MHC CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9BCN1 HLA-A PROTEIN PRECURSOR - Homo sapiens (Human).
Q9BCU2 MHC CLASS I RELATED PROTEIN, MR1B2 ISOFORM - Pan troglodytes (Chimpanzee).
Q9BCU3 MHC CLASS I RELATED PROTEIN, MR1B1 ISOFORM - Pan troglodytes (Chimpanzee).
Q9BCU4 MHC CLASS I RELATED PROTEIN, MR1B1 ISOFORM - Pan troglodytes (Chimpanzee).
Q9BCW3 MHC RFP-Y CLASS I ALPHA CHAIN - Gallus gallus (Chicken).
Q9BCY4 MHC CLASS I ANTIGEN - Papio cynocephalus (Yellow baboon).
Q9BCY5 MHC CLASS I ANTIGEN - Papio cynocephalus (Yellow baboon).
Q9BCY6 MHC CLASS I ANTIGEN - Papio cynocephalus (Yellow baboon).
Q9BCY7 MHC CLASS I ANTIGEN - Papio cynocephalus (Yellow baboon).
Q9BCY8 MHC CLASS I ANTIGEN - Papio cynocephalus (Yellow baboon).
Q9BCY9 MHC CLASS I ANTIGEN - Papio cynocephalus (Yellow baboon).
Q9BCZ0 MHC CLASS I ANTIGEN - Papio cynocephalus (Yellow baboon).
Q9BCZ1 SIMILAR TO HISTOCOMPATIBILITY 2, T REGION LOCUS 22 - Mus musculus (Mouse).
Q9BD06 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9BD49 MHC CLASS I RELATED PROTEIN MR1B2 ISOFORM - Pongo pygmaeus (Orangutan).
Q9BD50 MHC CLASS I RELATED PROTEIN MR1 ISOFORM - Pongo pygmaeus (Orangutan).
Q9BD51 MHC CLASS I ANTIGEN - Microcebus murinus (Lesser mouse lemur).
Q9BD52 MHC CLASS I ANTIGEN - Microcebus murinus (Lesser mouse lemur).
Q9BD53 MHC CLASS I ANTIGEN - Microcebus murinus (Lesser mouse lemur).
Q9D754 ADULT MALE TONGUE CDNA, RIKEN FULL-LENGTH ENRICHED LIBRARY, CLONE:2310032M04, FULL INSERT SEQUENCE - Mus musculus (Mouse).
Q9DBB7 ALPHA-2-GLYCOPROTEIN 1, ZINC - Mus musculus (Mouse).
Q9GIJ3 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9GIK4 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9GIK8 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9GIL3 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9GIP6 MHC CLASS I PRECURSOR - Gallus gallus (Chicken).
Q9GIW5 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I ANTIGEN A2 - Equus caballus (Horse).
Q9GIW6 MHC CLASS I ANTIGEN - Ictalurus punctatus (Channel catfish).
Q9GIW7 MHC CLASS I ANTIGEN - Ictalurus punctatus (Channel catfish).
Q9GIX2 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9GIY5 MHC CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9GIY7 MHC CLASS I ANTIGEN PRECURSOR (MAJOR HISTOCOMPATIBILITY COMPLEX, CLASS I, E) - Homo sapiens (Human).
Q9GIY8 MHC CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9GIZ0 MHC CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9GJ44 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9GJ45 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9GJ78 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I PRECURSOR - Macaca mulatta (Rhesus macaque).
Q9GJB8 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9GJB9 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9GJC0 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9GJC1 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9GJC2 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9GJE3 MHC CLASS I ANTIGEN - Marmota monax (Woodchuck).
Q9GJE4 MHC CLASS IA (HEAVY CHAIN PRECURSOR) - Fugu rubripes (Japanese pufferfish) (Takifugu rubripes).
Q9GKZ0 HFE PROTEIN - Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros).
Q9GL41 HFE PROTEIN - Rhinoceros unicornis (Greater Indian rhinoceros).
Q9GL42 HFE PROTEIN - Dicerorhinus sumatrensis (Sumatran rhinoceros).
Q9GL43 HFE PROTEIN - Diceros bicornis (Black rhinoceros).
Q9JHM2 MHC CLASS I PROTEIN PRECURSOR - Rattus norvegicus (Rat).
Q9JHN3 MHC CLASS I ANTIGEN - Marmota monax (Woodchuck).
Q9JHN4 MHC CLASS I ANTIGEN - Marmota monax (Woodchuck).
Q9JHN5 MHC CLASS I ANTIGEN - Marmota monax (Woodchuck).
Q9JHN6 MHC CLASS I ANTIGEN - Marmota monax (Woodchuck).
Q9JHN7 MHC CLASS I ANTIGEN - Marmota monax (Woodchuck).
Q9MW42 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q9MWK4 MHC CLASS I HEAVY CHAIN ANTIGEN - Gorilla gorilla (gorilla).
Q9MX28 MHC CLASS I PROTEIN UCA PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9MX69 MHC CLASS I PROTEIN - Ginglymostoma cirratum (Nurse shark).
Q9MXC6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXC7 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXC8 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXC9 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXD0 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXD1 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXD2 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXG3 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXG5 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXG6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH0 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH1 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH2 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH3 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH4 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH5 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH7 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH8 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXH9 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXI0 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXI1 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXI2 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXI3 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXI6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXI8 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXJ2 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXJ9 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK0 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK1 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK3 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK4 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK5 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK7 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXK9 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXL0 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXL4 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXL6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXL7 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXL8 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXL9 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM0 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM1 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM2 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM3 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM4 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM5 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXM7 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9MXQ3 MHC CLASS I ANTIGEN HEAVY CHAIN - Macaca mulatta (Rhesus macaque).
Q9MXR5 MHC CLASS I ANTIGEN HEAVY CHAIN - Macaca mulatta (Rhesus macaque).
Q9MXS3 MHC CLASS I HEAVY CHAIN ANTIGEN - Macaca mulatta (Rhesus macaque).
Q9MXS4 MHC CLASS I HEAVY CHAIN ANTIGEN - Macaca mulatta (Rhesus macaque).
Q9MXS5 MHC CLASS I HEAVY CHAIN ANTIGEN - Macaca mulatta (Rhesus macaque).
Q9MY33 LYMPHOCYTE ANTIGEN - Homo sapiens (Human).
Q9MY34 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I PRECURSOR - Homo sapiens (Human).
Q9MY52 HUMAN LEUCOCYTE ANTIGEN A - Homo sapiens (Human).
Q9MY72 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9MYA2 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9MYB7 HUMAN LEUCOCYTE ANTIGEN A PRECURSOR - Homo sapiens (Human).
Q9MYB8 HUMAN LEUCOCYTE ANTIGEN B - Homo sapiens (Human).
Q9MYC0 HUMAN LEUCOCYTE ANTIGEN B - Homo sapiens (Human).
Q9MYC3 HUMAN LEUCOCYTE ANTIGEN B - Homo sapiens (Human).
Q9MYG4 MHC CLASS I ANTIGEN HEAVY CHAIN - Homo sapiens (Human).
Q9MYG5 MHC CLASS I ANTIGEN HEAVY CHAIN - Homo sapiens (Human).
Q9MYI5 HLA CLASS I ANTIGEN - Homo sapiens (Human).
Q9MYI6 HLA CLASS I HISTOCOMPATIBILITY ANTIGEN B-57 - Homo sapiens (Human).
Q9NPL2 MR1 PROTEIN - Homo sapiens (Human).
Q9QYQ4 QA-1 - Mus musculus (Mouse).
Q9QYV4 M3 PROTEIN PRECURSOR - Rattus norvegicus (Rat).
Q9TNN4 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9TNN7 HLA CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9TNN8 MHC CLASS IA HEAVY CHAIN PRECURSOR (MHC CLASS I HEAVY CHAIN PRECURSOR) - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9TNR0 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I - Macaca mulatta (Rhesus macaque).
Q9TNR1 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I - Macaca mulatta (Rhesus macaque).
Q9TNR2 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I - Macaca mulatta (Rhesus macaque).
Q9TNR3 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I - Macaca mulatta (Rhesus macaque).
Q9TNR4 HLA-C CLASS I ANTIGEN=HLA-C*0801-MN16 VARIANT - Homo sapiens (Human).
Q9TNW9 MHC CLASS I HEAVY CHAIN PRECURSOR - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9TNX1 MHC CLASS I - Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri).
Q9TNZ1 PUTATIVE NON CLASSICAL MHC CLASS I ANTIGEN - Sus scrofa (Pig).
Q9TNZ2 PUTATIVE NON CLASSICAL MHC CLASS I ANTIGEN - Sus scrofa (Pig).
Q9TNZ3 NON CLASSICAL MHC CLASS I ANTIGEN - Sus scrofa (Pig).
Q9TP04 MHC CLASS I ANTIGEN - Protopterus aethiopicus (Marbled lungfish).
Q9TP68 DJ377H14.9 (MAJOR HISTOCOMPATIBILITY COMPLEX, CLASS I, F (CDA12)) - Homo sapiens (Human).
Q9TP69 DJ377H14.1 (MAJOR HISTOCOMPATIBILITY COMPLEX, CLASS I, G (HLA 6.0)) - Homo sapiens (Human).
Q9TP95 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9TP98 MHC CLASS I ANTIGEN - Rana pipiens (Northern leopard frog).
Q9TP99 MHC CLASS I ANTIGEN - Rana pipiens (Northern leopard frog).
Q9TPA0 MHC CLASS I ANTIGEN - Xenopus laevis (African clawed frog).
Q9TPA1 MHC CLASS I ANTIGEN - Xenopus laevis/gilli.
Q9TPA2 MHC CLASS I ANTIGEN - Xenopus laevis/gilli.
Q9TPA3 MHC CLASS I ANTIGEN - Xenopus laevis/gilli.
Q9TPA4 MHC CLASS I ANTIGEN - Xenopus laevis (African clawed frog).
Q9TPA5 MHC CLASS I ANTIGEN - Xenopus laevis/gilli.
Q9TPA6 MHC CLASS I ANTIGEN - Xenopus laevis (African clawed frog).
Q9TPA7 MHC CLASS I ANTIGEN - Xenopus laevis (African clawed frog).
Q9TPK7 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I PROTEIN - Monodelphis domestica (Short-tailed grey opossum).
Q9TPL0 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I PROTEIN - Monodelphis domestica (Short-tailed grey opossum).
Q9TPL2 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9TPL3 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9TPL4 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9TPL5 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9TPL6 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9TPL7 MHC CLASS I ANTIGEN - Pan troglodytes (Chimpanzee).
Q9TPW6 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9TPX2 HLA-C CLASS I ANTIGEN - Homo sapiens (Human).
Q9TQ65 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9TQ73 MHC CLASS I ANTIGEN HEAVY CHAIN - Homo sapiens (Human).
Q9TQ74 MHC CLASS I ANTIGEN HEAVY CHAIN - Homo sapiens (Human).
Q9TQ85 MHC CLASS I ANTIGEN PD1 - Sus scrofa (Pig).
Q9TQB1 MHC CLASS IB ANTIGEN QA-1D - Mus musculus (Mouse).
Q9TQB6 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9TQB9 MHC CLASS I-RELATED PROTEIN 1 ISOFORM D - Homo sapiens (Human).
Q9TQD4 MHC CLASS I ANTIGEN - Coturnix coturnix japonica (Japanese quail).
Q9TQD5 MHC CLASS I ANTIGEN - Coturnix coturnix japonica (Japanese quail).
Q9TQP6 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9TQP7 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9TQP9 HLA CLASS I ANTIGEN PRECURSOR - Homo sapiens (Human).
Q9TSW1 SWINE LEUCOCYTE ANTIGEN 2/2(SLA-2/2) - Sus scrofa (Pig).
Q9TSW2 SWINE LEUCOCYTE ANTIGEN 2/1(SLA-2/1) - Sus scrofa (Pig).
Q9TSW3 SWINE LEUCOCYTE ANTIGEN 3/2 (SLA-3/2) - Sus scrofa (Pig).
Q9TSW4 SWINE LEUCOCYTE ANTIGEN 3/1 (SLA-3/1) - Sus scrofa (Pig).
Q9TSW5 SWINE LEUCOCYTE ANTIGEN 5/2 (SLA-5/2) - Sus scrofa (Pig).
Q9TSW6 SWINE LEUCOCYTE ANTIGEN 5/1 (SLA-5/1) - Sus scrofa (Pig).
Q9UIN2 HUMAN LEUCOCYTE ANTIGEN A PRECURSOR - Homo sapiens (Human).
Q9UIP6 HUMAN LEUCOCYTE ANTIGEN B - Homo sapiens (Human).
Q9UQS8 HUMAN LEUCOCYTE ANTIGEN B PRECURSOR - Homo sapiens (Human).
Q9UQS9 HUMAN LEUCOCYTE ANTIGEN C PRECURSOR - Homo sapiens (Human).
Q9XR30 MHC CLASS I A - Oryzias latipes (Medaka fish).
Q9XR31 MHC CLASS I A - Oryzias latipes (Medaka fish).
Q9XRX0 MHC CLASS I PROTEIN - Brachydanio rerio (Zebrafish) (Zebra danio).
Q9XRX9 MHC CLASS I ANTIGEN - Pongo pygmaeus (Orangutan).
Q9XRY2 MHC CLASS I ANTIGEN - Pongo pygmaeus (Orangutan).
Q9XRY3 MHC CLASS I ANTIGEN - Pongo pygmaeus (Orangutan).
ZA2G_HUMAN Zinc-alpha-2-glycoprotein precursor (ZN-alpha-2-glycoprotein) (ZN-alpha-2-GP) - Homo sapiens (Human).
ZA2G_MOUSE Zinc-alpha-2-glycoprotein precursor (ZN-alpha-2-glycoprotein) (ZN-alpha-2-GP) - Mus musculus (Mouse).
ZA2G_RAT Zinc-alpha-2-glycoprotein precursor (ZN-alpha-2-glycoprotein) (ZN-alpha-2-GP) - Rattus norvegicus (Rat).

O19479 MHC CLASS I PROTEIN - Ginglymostoma cirratum (Nurse shark).
O19633 HLA-A26NULL ALLELE - Homo sapiens (Human).
O46704 MAJOR HISTOCOMPATIBILITY COMPLEX CLASS I PROTEIN - Fugu rubripes (Japanese pufferfish) (Takifugu rubripes).
O75930 HEMOCHROMATOSIS SPLICE VARIANT DELE2 - Homo sapiens (Human).
O75931 HEMOCHROMATOSIS SPLICE VARIANT DELE214E4 - Homo sapiens (Human).
O95733 HUMAN LEUCOCYTE ANTIGEN B - Homo sapiens (Human).
Q31062 MHC CLASS I PD6-GLYCOPROTEIN - Sus scrofa (Pig).
Q31205 HISTOCOMPATIBILITY 2, T REGION LOCUS 10 (MHC CLASS I H2-TL-T10-B MRNA , COMPLETE CDS) (B HAPLOTYPE) - Mus musculus (Mouse).
Q62143 Q8/9D PEPTIDE - Mus musculus (Mouse).
Q9CZ20 HISTOCOMPATIBILITY 2, Q REGION LOCUS 8 - Mus musculus (Mouse).
Q9GIL2 MHC CLASS I ANTIGEN - Homo sapiens (Human).
Q9R105 HEMOCHROMATOSIS GENE PRODUCT HFE SPLICE VARIANT DELE2 - Rattus norvegicus (Rat).
Q9TNS9 HLA-B*2705 ALPHA 2 DOMAIN - Homo sapiens (Human).

Q30717 MHC CLASS I ANTIGEN MAMU A*05 - Macaca mulatta (Rhesus macaque).
Q31599 MHC CLASS I-ALPHA - Xenopus laevis (African clawed frog).
Q61640 MUSCULUS MUTANT H-2D4(Q) PRECURSOR - Mus musculus (Mouse).
Q9HC83 HEMOCHROMATOSIS SPLICE VARIANT DELE3-7 - Homo sapiens (Human).
Scan History
SPTR40_18f 7  720  NSINGLE    
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS 1C04_HUMAN 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS 1A11_HUMAN 83 83 -
YWDEETRSAKAHSQTDRVDLGTLRGYYNQS 1A01_PANTR 83 83 -
YWDRNTRNVKAHSQTDRVDLGTLRGYYNQS 1A01_GORGO 83 83 -
YWDRETRSVKAHAQTNRVDLGTLRGYYNQS 1A01_PONPY 83 83 -
YWEEETRKGKADAQTFRVDLQTLLGYYNQS 1A01_SAGOE 83 83 -
YWDQNTRNSKGAAQTFRVDLNTLRGYYNQS Q30287 58 58 -
YWVLQTRNSKASAQTFRVNLQTLLGYYNQS 1C01_SAGOE 83 83 -
YWEQQTRIAKEWEQIYRVDLRTLRGYYNQS HA12_RAT 83 83 -
YWDRQTRTIKETARTFRVDLDTLRGYYNQS HA19_CANFA 83 83 -
YWDRETQRGQNNQQFYRCGLGTLRGRYNQS O62881 81 81 -
FWETQTKIAKAHAQKLSWNLRSTLRYCNQS Q9GJE3 80 80 -
YWERETERARGTEPVERANVGIVMERLNQT P79458 79 79 -
YWERETQNARGAEQWGKVNIPILSERTNQS O46836 73 73 -
YWESQTGNCKGQQQTFKANIDIVNQRFNQS Q9GJB8 78 78 -
YWDEETQIMRGAEAVSKHNVQTVMSRFNQT Q9TP99 76 76 -
FWQRNTQIRSNMHQLFKNNINIAMERFNQT Q9XRX0 73 73 -

Motif 2 width=17
Element Seqn Id St Int Rpt
GSHTLQRMYGCDLGPDG 1C04_HUMAN 115 2 -
GSHTIQIMYGCDVGPDG 1A11_HUMAN 115 2 -
GSHTIQIMYGCDVGSDG 1A01_PANTR 115 2 -
GSHTIQRMYGCDVGSDG 1A01_GORGO 115 2 -
GSHTIQRMFGCDVGPDG 1A01_PONPY 115 2 -
GSHTIQWMYGCDLGPDG 1A01_SAGOE 115 2 -
GSHTIQAMYGCDVGPDG Q30287 90 2 -
GFHTIQWMYGCDLGPDG 1C01_SAGOE 115 2 -
GSHTIQEMYGCDVGSDG HA12_RAT 115 2 -
GSHTRQTMYGCDLGPDG HA19_CANFA 115 2 -
GAHTLQLMYGCDLLEDG O62881 112 1 -
GSHTFQWISGCDLGPHG Q9GJE3 112 2 -
GLHTVQQMYGCELRGDG P79458 110 1 -
GIHVLQRMYGCELREDG O46836 104 1 -
GVHTFQLMYGCELGDDG Q9GJB8 109 1 -
GIHSFQLMYGCELRDDG Q9TP99 107 1 -
GVHTFQFMVGCELEDDG Q9XRX0 104 1 -

Motif 3 width=18
Element Seqn Id St Int Rpt
GYDQSAYDGKDYIALNED 1C04_HUMAN 136 4 -
GYRQDAYDGKDYIALNED 1A11_HUMAN 136 4 -
GYRQDAYDGKDYIALNED 1A01_PANTR 136 4 -
GYQQDAYDGKDYIALNED 1A01_GORGO 136 4 -
GYEQHAYDGKDYIALNED 1A01_PONPY 136 4 -
GYDQHAYDGKDYIALNED 1A01_SAGOE 136 4 -
GYRQDAYDGRDYIALNED Q30287 111 4 -
GYHQYAYDGKDYIALNED 1C01_SAGOE 136 4 -
GYRQDAYDGRDYIALNED HA12_RAT 136 4 -
GYSQDAYDGADYIALNED HA19_CANFA 136 4 -
GYWQYAYDGRDFIAFDTD O62881 132 3 -
GYEEFAYDGADYISLNED Q9GJE3 133 4 -
GFMQYAYDGGDFLSFDKD P79458 130 3 -
GFFRDGWDGKDSIVFDKE O46836 124 3 -
GDFQLGYDGADFLSLDKS Q9GJB8 129 3 -
GYYQYGYDGRDFMYLDTE Q9TP99 127 3 -
GHWQYGYDGEDFISFDKN Q9XRX0 124 3 -

Motif 4 width=19
Element Seqn Id St Int Rpt
RAYLEGECVEWLRRYLENG 1C04_HUMAN 181 27 -
RAYLEGRCVEWLRRYLENG 1A11_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1A01_PANTR 181 27 -
RAYLEGTCVEWLRRHLENG 1A01_GORGO 181 27 -
RAYLEGLCVESLRRYLENG 1A01_PONPY 181 27 -
RAYLEGTCVEWLHRYLENG 1A01_SAGOE 181 27 -
RNYLEGTCVEWLRRYLENG Q30287 156 27 -
RAYLEGTCVEWLRRHLENG 1C01_SAGOE 181 27 -
RAYLEGTCVEWLSRYLELG HA12_RAT 181 27 -
RNYLETTCVEWLRRYLEMG HA19_CANFA 182 28 -
KHYLQNTCVEWLTKYVSYG O62881 178 28 -
RAYLQEECLEWLRRFLEKG Q9GJE3 178 27 -
KAYLEGECIEWLQKYLQYG P79458 176 28 -
KGYLEGICIEWLKKYLRYG O46836 170 28 -
KNYLENTCIEWLKKYVNYG Q9GJB8 175 28 -
KNYLENLCIEWLKKHINNG Q9TP99 174 29 -
KQYLENQCIEWLRKYVGYG Q9XRX0 170 28 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS 1C12_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS 1C13_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q9TNR4 52 52 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS Q9TNN7 83 83 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS Q9TPX2 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS O78179 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q9MY34 83 83 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS 1C04_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS O78214 83 83 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS Q29862 83 83 -
YWDRETQNYKRQAQADRVSLRNLRGYYNQS O19617 83 83 -
YWDRETQNYKRQAQADRVSLRNLRGYYNQS Q95463 83 83 -
YWDRETQNYKRQAQADRVSLRNLRGYYNQS Q9GIK4 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q31603 83 83 -
YWDRETQICKAKAQTDRESLRNLRGYYNQS Q29961 83 83 -
YWDRETQIFKTNTQTYRESLRNLRGYYNQS Q29767 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS 1B44_HUMAN 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS 1C15_HUMAN 83 83 -
YWDRETQISKTNTQTYRENLRTLLRYYNQS Q9MXM0 83 83 -
YWDRETQICKAKAQTDRESLRTLLRYYNQS 1B19_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS P79490 83 83 -
YWDRNTQISKTNTQTYRESLRNLRGYYNQS Q9UIP6 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B11_HUMAN 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q95343 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q9MYC0 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS 1B39_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS P79489 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS P79555 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q29848 83 83 -
YWDRETQKYKRQAQTDRVSLRKLRGYYNQS 1C01_GORGO 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS Q31627 83 83 -
YWDRETQICKTNTQTYRESLRNLRGYYNQS Q9BD06 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS 1B02_HUMAN 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B38_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q29638 83 83 -
YWDRNTQICKTNTQTYRESLRNLRGYYNQS Q08173 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS 1C11_HUMAN 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS Q9TQP9 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS Q29652 83 83 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS 1C02_GORGO 83 83 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS 1C04_GORGO 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q29854 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q31610 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q31613 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B34_HUMAN 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B46_HUMAN 83 83 -
YWDRNTQICKAQAQTDRGSLGNLRGYYNQS Q9MXC8 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q30173 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS 1C16_HUMAN 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS O78211 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q29963 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B48_HUMAN 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q9GIZ0 83 83 -
YWDRNTQIYKTNTQTYRESLRNLRGYYNQS Q29982 83 83 -
YWDRNTQIYKTNTQTDRESLRNLRGYYNQS Q29681 83 83 -
YWDRNTQIYKTNTQTDRESLRNLRGYYNQS Q29861 83 83 -
YWDRNTQIFKTNTQTDRESLRNLRGYYNQS 1B04_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS 1C02_HUMAN 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q9MXH3 83 83 -
YWDRNTQISKTNTQTYRESLRNLRGYYNQS Q29943 83 83 -
YWDRETQICKAKAQTDRESLRTLLRYYNQS Q29693 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B36_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS P79549 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS Q29981 83 83 -
YWDRNTQICKTNTQTYRESLRNLRGYYNQS O19790 83 83 -
YWDRQTQISKTNTQTYRESLRNLRGYYNQS Q9MXH4 83 83 -
YWHRETQKYKRQAQADRVSLRNLRGYYNQS Q9MXC9 83 83 -
YWDRETQKYNRQAQTDRVNLRKLRGYYNQS 1C03_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS 1C17_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS O78178 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q29641 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q30192 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS 1C14_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS 1B59_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRVGLGNLRGYYNQS Q9MXI1 83 83 -
YWDRNTQIYKAQAQTDRVGLGNLRGYYNQS Q9MXK3 83 83 -
YWDRETQISKTNTQTDRESLRNLRGYYNQS 1B32_HUMAN 83 83 -
YWDRETQISKTNTQTYREDLRTLLRYYNQS Q29705 83 83 -
YWDRETQICKAKAQTDREDLRTLLRYYNQS 1B14_HUMAN 83 83 -
YWDRETQICKAKAQTDREDLRTLLRYYNQS 1B18_HUMAN 83 83 -
YWDRETQICKAKAQTDREDLRTLLRYYNQS O78189 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q29748 83 83 -
YWHRETQKYKRQAQADRVSLRNLRGYYNQS Q9MXL6 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q9UQS9 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS O02865 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q29836 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS Q29855 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS Q9TPW6 83 83 -
YWDRNTQIYKAQAQTDRVSLGNLRGYYNQS Q9MXK4 83 83 -
YWDRNTRKVKAQSQTDRVDLGTLRGYYNQS 1A34_HUMAN 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q9MXD0 83 83 -
YWDRETQISKTNAQTYRESLRNLRGYYNQS 1B02_PANTR 83 83 -
YWDRETQISKTNAQTYRESLRNLRGYYNQS Q9MXK0 83 83 -
YWDRETQICKAKAQTDREDLRTLLRYYNQS Q29846 83 83 -
YWDRETQICKAKAQTDRESLRTLLRYYNQS P79612 83 83 -
YWDRETQNYKRQAQTDRVNLRKLRGYYNQS Q29864 83 83 -
YWDRNTQICKTNTQTDRESLRNLRGYYNQS 1B07_HUMAN 83 83 -
YWDRNTQICKTNTQTDRESLRNLRGYYNQS 1B08_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q29959 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q29960 83 83 -
YWDRETQISKTNTQTYRENLRIALRYYNQS Q9MXH2 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q29842 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS O46684 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q9MXD2 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q9TPL2 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS O78083 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS Q95603 83 83 -
YWDRNTQIYKTNTQTDRESLRNLRGYYNQS Q29749 83 83 -
YWDRNTQIYKAQAQTDRENLRIALRYYNQS Q9MXH5 83 83 -
YWDRETQISKANTQSYRESLGILRGYYNQS Q9XRY3 83 83 -
YWHRETQKYKRQAQADRVSLRNLRGYYNQS Q9MXC6 83 83 -
YWHRETQKYKRQAQADRVSLRNLRGYYNQS Q9MXG6 83 83 -
YWDRETQISKTNAQTYRVGLRNLRGYYNQS Q9MXI2 83 83 -
YWDRETQISKTNAQTYRVGLRNLRGYYNQS Q9TPL5 83 83 -
YWDRETQISKTNAQTDRENLRTLLRYYNQS Q9MXL9 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q9MXL7 83 83 -
YWDRNTQISKTNTQTYRESLRNLRGYYNQS 1B10_HUMAN 83 83 -
YWDRETQICKAKAQTDREDLRTLLRYYNQS 1B20_HUMAN 59 59 -
YWDRNTQICKTNTQTDRESLRNLRGYYNQS 1B31_HUMAN 83 83 -
YWDRNTQICKTNTQTDRESLRNLRGYYNQS Q29847 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS 1C07_HUMAN 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q29921 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q29865 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS P79498 83 83 -
YWDRETQISKTNTQTYREDLRTLLRYYNQS 1B29_HUMAN 83 83 -
YWDRNTQIFKAQAQTDRVGLGNLRGYYNQS Q9MXM1 83 83 -
YWDRETQISKTNTQTYREDLRTLLRYYNQS 1B45_HUMAN 83 83 -
YWDRETQISKTNTQTYREDLRTLLRYYNQS Q9GIL3 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B12_HUMAN 83 83 -
YWDRNTQICKTNTQTYRESLRNLRGYYNQS Q29844 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q30172 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q9TP95 83 83 -
YWDRETQISKTNTQTYRENLRIALRYYNQS Q9MXH1 83 83 -
YWDRNTQICKTNTQTYRESLRNLRGYYNQS Q29852 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS 1CXX_HUMAN 59 59 -
YWDRETQISKTNAQTDRENLRTLLRYYNQS Q9MXH0 83 83 -
YWDRNTRNVKAQSQTDRVDLGTLRGYYNQS 1A66_HUMAN 83 83 -
YWDRNTQISKTNTQTDRESLRNLRGYYNQS Q9BCM6 83 83 -
YWDRNTRNVKAHSQTDRENLGTLRGYYNQS P79563 83 83 -
YWDRETQICKAKAQTDRENLRIALRYYNQS 1B15_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS 1B25_HUMAN 83 83 -
YWDRETQKYNRQAQTDRVSLRNLRGYYNQS 1C01_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q29992 83 83 -
YWDRNTQISKTNTQTYRESLRNLRGYYNQS 1B13_HUMAN 83 83 -
YWDRETQKYKRQAQTDRVNLRKLRGYYNQS 1C03_GORGO 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS 1B55_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS 1B56_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS 1B57_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS P79523 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS 1C06_HUMAN 83 83 -
YWDRNTQICKTNTQTYRESLRNLRGYYNQS O19554 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B43_HUMAN 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS O78172 83 83 -
YWDRNTQIFKTNTQTDRENLRTALRYYNQS Q29637 83 83 -
YWDRETRNMKASAQTYRENLRIALRYYNQS Q31602 83 83 -
YWDRETRNMKASAQTYRENLRIALRYYNQS Q9GIX2 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q9GIK8 83 83 -
YWDRNTRNVKAHSQTDRANLGTLRGYYNQS 1A26_HUMAN 83 83 -
YWDRNTRNVKAHSQTDRANLGTLRGYYNQS Q95377 83 83 -
YWDRNTRNVKAHSQTDRANLGTLRGYYNQS Q9MY52 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS 1B35_HUMAN 83 83 -
YWDRETQNYKRQAQTDRVNLRKLRGYYNQS Q31605 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS Q29747 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS 1B58_HUMAN 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q9BCM7 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q9TPL4 83 83 -
YWDRETQKYKRQAQADRVNLRKLRGYYNQS Q95604 83 83 -
HWDRETQICKAKAQTDREDLRTLLRYYNQS 1B16_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS O78218 83 83 -
YWDRETQISKTNTQTYRENLRIALRYYNQS 1B47_HUMAN 83 83 -
YWDRETQNYKRQAQTDRVNLRKLRGYYNQS 1C18_HUMAN 83 83 -
YWDRETQNYKRQAQTDRVNLRKLRGYYNQS O78165 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q29644 83 83 -
YWDQETRNVKAHSQTDRVDLGTLRGYYNQS 1A74_HUMAN 83 83 -
YWDRNTRIYKANTQTYRESLRNLRGYYNQS Q9TNR1 59 59 -
YWDRETQKYKPQAQTDRVSLRNLRGYYNQS 1C05_HUMAN 83 83 -
YWDRNTQICKTNTQTYRENLRIALRYYNQS Q29932 83 83 -
YWDRNTQISKTNTQTYRESLRNLRGYYNQS Q29845 83 83 -
YWDGETRKVKAHSQTDRANLGTLRGYYNQS Q9MW42 83 83 -
YWDEETRSVKASAQTDRVDLGTLRGYYNQS Q9MXK9 83 83 -
YWDRETQISKTNAQTYRESLRNLRGYYNQS 1A02_PANTR 83 83 -
YWDRETQISKTNAQTYRESLRNLRGYYNQS Q9MXI3 83 83 -
YWDRETQTSKAQAQTDRENLRIALRYYNQS 1B01_GORGO 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS 1B22_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS O19755 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS Q29669 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS 1A11_HUMAN 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS Q9BCN0 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS Q9MYI5 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS Q9TQP6 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS Q9TQP7 83 83 -
YWDRNTQICKTNTQTDRESLRNLRGYYNQS Q29858 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS 1B23_HUMAN 83 83 -
YWHRETQKYKRQAQADRVSLRNLRGYYNQS Q9MXC7 83 83 -
YWHRETQKYKRQAQADRVSLRNLRGYYNQS Q9MXG5 83 83 -
YWDRNTQICKTNTQTDRESLRNLRGYYNQS Q29697 83 83 -
YWDRETQTSKAQAQTDRENLRIALRYYNQS 1B03_GORGO 83 83 -
YWDRETQISKTNAQTDRVSLRNLLRYYNQS Q9MXD1 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS Q29700 83 83 -
YWDRNTQGIKTQAQTDRENLRTLLRYYNQS Q9MXK1 83 83 -
YWDRNTQICKTNTQTYRENLRTALRYYNQS Q29935 83 83 -
YWDGETRNMKARSQTDRVDLGTLRGYYNQS 1A03_GORGO 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS 1B21_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS 1B27_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS 1B28_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS Q9MY33 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS 1B26_HUMAN 83 83 -
YWDRETQTSKAQAQTDRENLRIALRYYNQS 1B02_GORGO 83 83 -
YWDRQTQISKTNAQTDRGSLGNLRGYYNQS Q9MXH7 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q29633 83 83 -
YWDRETQISKTNTQTYRESLRNLRGYYNQS Q29985 83 83 -
YWDRETQISKTNTQTYRVGLGTLRGYYNQS 1B04_GORGO 83 83 -
YWDRNTQISKTNTQTYRENLRIALRYYNQS Q29911 83 83 -
YWDRETQNYKRQAQADRVNLRKLRGYYNQS Q29991 83 83 -
YWDRETQISKTNAQTDRESLRNLLRYYNQS Q9MXI0 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS 1A30_HUMAN 83 83 -
YWDRNTQIFKTNTQTDRESLRNLRGYYNQS 1B63_HUMAN 83 83 -
YWDRNTRNVKAHSQTDRESLRIALRYYNQS 1A25_HUMAN 83 83 -
YWDEETRSAKAHSQTDRVDLGTLRGYYNQS 1A01_PANTR 83 83 -
YWDRETRNVKASAQTDRENLRIALRYYNQS Q9MXH6 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS O78180 83 83 -
YWDLQTRNVKAHSQTDRANLGTLRGYYNQS 1A43_HUMAN 83 83 -
YWDQETRSAKAHSQTDRVDLGTLRGYYNQS Q9TPL7 83 83 -
YWDGETRKVKAHSQTDRVNLGTLRGYYNQS 1A02_GORGO 83 83 -
YWDEETRSAKASAQTNRVDLGTLRGYYNQS Q9MXM7 83 83 -
YWDRNTQICKTNTQTYRENLRIALRYYNQS Q95365 83 83 -
YWDRNTQIFKTNTQTYRESLRNLRGYYNQS Q29924 83 83 -
YWDQETRNMKASAQTDRVDLGTLRGYYNQS 1A03_PANTR 83 83 -
YWDRETQISKTNAQTYRVGLRNLLRYYNQS Q9MXK5 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS 1B05_HUMAN 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q9MYB8 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS 1B41_HUMAN 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS 1B42_HUMAN 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS P79524 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS Q29850 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS Q29661 83 83 -
YWDRNTQIFKTNTQTYRENLRIALRYYNQS Q29857 83 83 -
YWERETQKAKGNEQNYRVSLRNLRGYYNQS O19446 83 83 -
YWERETQKAKGNEQNYRVSLRNLRGYYNQS Q31266 73 73 -
YWDRETRNVKASAQTDRGSLRNLRGYHNQS Q9MXM2 83 83 -
YWDRNTQICKAKAQTDRVGLRNLRGYYNQS Q31612 83 83 -
YWDQETQKAKTQAQNDRVSLQNLRGYYNQS Q9XRX9 83 83 -
YWDRNTRNSKVTAQTFRVGLGNLRGYYNQS Q30719 83 83 -
YWDRNTRNVKAHSQTDRVDLGTLRGYYNQS 1A01_GORGO 83 83 -
YWDQNTRICKADTQTYRESLRNLRGYYNQS Q30720 80 80 -
YWDRETRNMKASAQTDRENLRIALRYYNQS Q9MXJ9 83 83 -
YWDQETRNVKAHSQTDRESLRIALRYYNQS 1A32_HUMAN 83 83 -
YWDQETRNVKAHSQTDRESLRIALRYYNQS Q9GJ44 83 83 -
YWDQETRNVKAHSQTDRESLRIALRYYNQS Q9GJ45 83 83 -
YWDRETQKYKRQAQTDRVSLRNLRGYYNQS Q29993 83 83 -
YWDRQTQIYKRQAQADRVNLRKLRGYYNQS Q9MXG3 83 83 -
YWDRNTQISKTNTQTYRENLRTALRYYNQS Q9MYC3 83 83 -
YWDQETRNMKAHSQTDRANLGTLRGYYNQS 1A36_HUMAN 83 83 -
YWDQNTRICKADTQTYRESLRNLRGYYNQS Q9TNR2 59 59 -
YWDQETRNVKAHSQIDRVDLGTLRGYYNQS 1A31_HUMAN 83 83 -
YWERETQISKTNTQTYRENLRTALRYYNQS Q9UQS8 83 83 -
YWDRETRNMKASAQTYRENLRIALRYYNQS Q29941 83 83 -
YWEEETRRAKGNAQTFRVGLGNLRGYYNQS Q30712 83 83 -
YWDRETRNMKAFAQTYRENLRIALRYYDQS Q9MXM4 83 83 -
YWDRNTRNVKAQSQTDRVDLGTLRGYYNQS 1A68_HUMAN 83 83 -
YWDRETRSVKAHAQTNRVDLGTLRGYYNQS 1A01_PONPY 83 83 -
YWDRNTQIFKTNTQTYRENLRIALRYYNQS Q29940 83 83 -
YWDEETRSVKASAQTDRVDLGTLRGYYNQS 1A04_PANTR 83 83 -
YWDQETGKVKAHSQTDRESLRIALRYYNQS Q9MYG5 83 83 -
YWDRETRNVKASAQTDRENLRIALRYYNQS Q9TPL6 83 83 -
YCDRETQIFKTNTQTDRGSLGNLRGYYNQS Q9MXH8 83 83 -
YWEEETRNAKGHAQTDRADLGNLRGYYNQS Q30711 80 80 -
YWEEETRRAKGHAQTDRADLGTLRGYYNQS Q30716 83 83 -
YCDRETQIFKTNTQTDRVSLGNLGGYYNQS Q9MXH9 83 83 -
YWDRNTRNVKAQSQTDRVDLGTLRGYYNQS Q9UIN2 83 83 -
YWDRNTQIFKTNTQTYRENLRIALRYYNQS Q29849 83 83 -
YWEEETRKGKADAQTFRVDLQTLLGYYNQS 1A01_SAGOE 83 83 -
YWDRETQISKTNTQTYRENLRIALRYYNQS 1B53_HUMAN 83 83 -
YWDQNTRNSKGAAQTFRVDLNTLRGYYNQS Q30287 58 58 -
YWDEETRSVKASAQTDRANLGTLRGYYNQS Q9MXL0 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS 1A03_HUMAN 88 88 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS Q9MYG4 83 83 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS O19756 83 83 -
YWDRETQRAKGNAQIFRVSLNNLRGYYNQS Q95394 83 83 -
YWDGETRNMKASAQTYRENLRIALRYYNQS Q29925 83 83 -
YWDRNTQIFKTNTQTYRENLRIALRYYNQS 1B54_HUMAN 83 83 -
YWDEETRSVKAFAQTDRANLGTLRGYYNQS Q9MXI8 83 83 -
YWDEETRSVKAFAQTDRANLGTLRGYYNQS Q9TPL3 83 83 -
YWDRETRNVKASAQTDRENLRIALRYYNQS Q30988 83 83 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS Q9TQB6 83 83 -
YWDRNTQIFKTNTQTYRENLRTRLRYYNQS Q29938 83 83 -
YWDRNTQIYKAQAQTDRESLRNLRGYYNQS Q29718 83 83 -
YWDRNTRNVKAHSQIDRVDLGTLRGYYNQS 1A33_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRENLRIALRYYNQS 1B49_HUMAN 83 83 -
YWDRNTQIFKTNTQTYRENLRIALRYYNQS O78173 83 83 -
YWDRETRNVKAFALTDRENLRTLLRYYNQS Q9MXM3 83 83 -
YWDRETQISKTNTQTYRENLRTALRYYNQS Q9GIY5 83 83 -
YWERNTQIAKGQAQTDRVDLRTLRGYYNQS Q9BD51 83 83 -
YWDRNTRICKANTQTYRESLRNLLRYYNQS Q30718 83 83 -
YWDGETRKVKASAQIYRVGLGTLRGYYNQS Q9MWK4 83 83 -
YWDRETRISKANTQTYRENLRTALRYYNQS Q9GJ78 83 83 -
YWDRNTQIFKTNTQTYRENLRIALRYYNQS 1B52_HUMAN 83 83 -
YWERNTRIYKDTAQTYRENLRIALGYYNQS Q30482 80 80 -
YWDLQTRNVKAQSQTDRANLGTLRGYYNQS 1A29_HUMAN 83 83 -
YWDQETRSVKAGAQIYRANLGTLRGYYNQS Q9MXK7 83 83 -
YWDRETRKAKGNAQTDRENLRIALSYYNQS Q30595 80 80 -
YWDRNTQIYKAQAQTDRVDLETLRGYYNQS 1OKO_GORGO 83 83 -
YWDGETRNMKASAQTYRENLRIALRYYNQS 1B62_HUMAN 83 83 -
YWDQETRNVKAHSQTDRVNLGTLRGYYNQS Q30900 83 83 -
YWDGETRNMKASAQTYRENLRIALRYYNQS 1B61_HUMAN 83 83 -
YWDGETRNMKASAQTYRENLRIALRYYNQS P79496 83 83 -
YWDRETKKYNPQAQTDRVSLRNLRGYYNQS Q29988 83 83 -
YWDGNTQGVKTQAQTDRESLRNLRGYYNQS Q9MXL8 83 83 -
YWDQETRSVKAFAQTDRANLGTLRGYYNQS Q9MXM6 83 83 -
YWDRQTQISKTNAQIELESLRIALRYYNQS 1A04_GORGO 83 83 -
YWDGETRNMKASAQTYRENLRIALRYYNQS 1B60_HUMAN 83 83 -
YWDGETRNMKASAQTYRENLRIALRYYNQS Q9MYI6 83 83 -
YWDRETQNMKAQTQNAPVNLRNLRGYYNQS Q30868 83 83 -
YWEGQTQIAKGNEQSFRVNLRTLLGYYNQS Q31142 80 80 -
YWDRETQNMKAQTQNAPVNLRNLRGYYNQS Q9BCY9 83 83 -
YWDRETQKYKRQAQADRVSLRNLRGYYNQS 1C01_PANTR 83 83 -
YWDQETRNMKASAQTDRVDLGTLRGYYNQS Q9MXM5 83 83 -
YWDRNTQICKAQAQTERENLRIALRYYNQS HLAH_HUMAN 83 83 -
YWDEETRSAKAHSQTDRVDLGTLRGYYNQS Q9MXI6 83 83 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS 1A02_HUMAN 83 83 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS O78126 80 80 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS P79603 83 83 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS Q9MYB7 83 83 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS Q9TQ73 83 83 -
YWDRNTQICKTNTQIYRENLRNLRGYYNQS Q9XRY2 83 83 -
YWDRETRSVKAGAQIYRANLGTLRGYYNQS Q9MXL4 83 83 -
YWEEQTRRAKGHAQTDLGSLRILRGYYNQS Q30871 83 83 -
YWEEQTRRAKGHAQTDLGSLRILRGYYNQS Q9BCY7 83 83 -
YWEEETRIVKGNAQIDRVDLNTLRGYYNQS Q30485 80 80 -
YWVLQTRNSKASAQTFRVNLQTLLGYYNQS 1C01_SAGOE 83 83 -
YWDEETRNVKAHSQTNRANLGTLRGYYNQS 1A80_HUMAN 83 83 -
YWDEETRSVKASAQTDRVDLGTLRGYYNQS Q9MXJ2 83 83 -
YWERETQRAKGQEQSFRVDLRTLLGYYNQS Q31172 80 80 -
YWDRETQNMKTETQNAPVALRNLRGYYNQS Q9MXS5 83 83 -
YWEEETRIAKARAQTDRGNLRTALRYYNQS Q9MXQ3 83 83 -
YWDQETRSVKAGAQINRANLGTLRGYYNQS Q30901 83 83 -
YWDRETRNSKETAQTFRANLNNALGYYNQS O77975 80 80 -
YWDRNTRIYKAETQNAPVALRNLRGYYNQS Q30591 55 55 -
YWEQQTRIAKEWEQIYRVDLRTLRGYYNQS HA12_RAT 83 83 -
YWERITQIAKGQEQWFRVNLRTLLGYYNQS Q31196 78 78 -
YWDQETRNMKAHSQTDRANLGTLRGYYNQS 1A01_HUMAN 83 83 -
YWDRETRNMKTETQNAPVNLRTLLRYYNQS Q9TNR3 59 59 -
YWEEETQRAKAFAQTFRVNLQTALGYYNQS 1B01_SAGOE 83 83 -
YWERITQIAKGQEQWFRVNLRTLLGYYNQS HA1L_MOUSE 83 83 -
YWERNTRISKDSAQNDRVSLRNLRGYYNQS Q9BD53 83 83 -
YWEQQTRIAKENEQVNRVDLRTLRGYYNQS Q31254 80 80 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS Q9TQ65 83 83 -
YWDGETRKVKAHSQTHRVDLGTLRGYYNQS Q29757 83 83 -
YWEEETRIAKARAQTERGNLRTALRYYNQS Q9MXR5 83 83 -
YWEEETRIAKARAQTERGNLRTALRYYNQS Q9MXS3 83 83 -
YWDRETQISKENALWYREALNNLRGYYNQS Q30291 80 80 -
YWEEATRRAKGNAQTHRGNLRTALRYYNQS Q30715 83 83 -
YWERNTRIFKDTAQTFRVSLNNLRGYYNQS Q9GIW5 83 83 -
YWDEETGKVKAHSQTDRENLRIALRYYNQS Q9TQ74 83 83 -
YWDRNTRIVKAETQNAPVNLQNLRGYYNQS Q30870 83 83 -
YWDRNTRIVKAETQNAPVNLQNLRGYYNQS Q9BCZ0 83 83 -
YWEEETRIAKGHAQTERGNLRTLLRYYNQS Q30714 15 15 -
YWDRNTRNAKGNAQSFRVNLNTLRGYYNQS HA1A_BOVIN 80 80 -
YWDEETRISKANTQTYRESLRNLRGYYNQS Q9TNR0 59 59 -
YWEPETQKAKGQEQWFRVNLRILLGYYNQS Q31149 83 83 -
YWDEETQNAMGSAQTFRVNLKNLRGYYNQS O19242 80 80 -
YWDEQTRIVKDTAQTFRANLNTALGYYNQS Q95393 80 80 -
YWDRETRIMKTETQNAPVALRNLRGYYNQS Q30592 55 55 -
YWERNTRIAKENEQNYRVSLRTALHYYNQS Q31255 80 80 -
YWERETQIAKGNEQSFRVDLRTLLRYYNQS HA13_MOUSE 83 83 -
YWDQETRSARDTAQTFRVNLDTLRGYYNQS Q9BCY4 77 77 -
YWDEETGKVKAHSQTDRANLGTLRGYYNQS Q29907 83 83 -
YWERNTQIAKGNEQIFRVNLRTALRYYNQS HA1K_MOUSE 80 80 -
YWERNTQIAKGNEQIFRVNLRTALRYYNQS Q95458 80 80 -
YWEGQTQNAKSNEQIFRVNLRTLLGYYNQS Q31188 83 83 -
YWDQETRNMKAFAQIYRANLGTLRGYYNQS Q9MXK6 83 83 -
YWERNTQIAKDNEQSSRVDLRTLLRYYNQS HA1W_MOUSE 80 80 -
YWERNTQIAKGNEQIFRVSLRTALRYYNQS Q31173 80 80 -
YWERNTRISKDNAQNDRVNLRNLRGYYNQS Q9BD52 83 83 -
YWEEETRTAKGHAQTFRGNLRIALGYYNQS Q30483 80 80 -
YWERETQKAKGNEQSFRVDLRTLLGYYNQS HA1B_MOUSE 80 80 -
YWEEQTQIAKGNEQRSRVNLRTALRYYNQS Q61895 80 80 -
YWEEETRNTKAHAQTDRMNLQTLRGYYNQS HLAG_HUMAN 83 83 -
YWEEETRNTKAHAQTDRMNLQTLRGYYNQS Q9TP69 80 80 -
YWEEETRNTKAHAQTDRMNLQTLRGYYNQS Q30182 83 83 -
YWERETQRAKGNEQSFHVSLRTLLGYYNQS Q31214 83 83 -
YWERITQIAKDNEQSSRVDLRTALRYYNQS Q61896 80 80 -
YWEEETRIAKARAQTERGNLRTALRYYNQS Q30721 83 83 -
YWDRQTRTIKETARTFRVDLDTLRGYYNQS HA19_CANFA 83 83 -
YWERETQKAKRHEQSFRVSLRTLLSYYNHS Q31155 83 83 -
YWERETQKSKSNEQWFRVSLRTALRYYNQS Q61894 80 80 -
YWDRETQISKENALWYREALNNLRGYYNQS O77976 80 80 -
YWERNTRTAKDNAQAFRVSLNNLRGYYNQS Q30488 79 79 -
YWERNTQIAKGNEQSFRVNLRTALRYYNQS Q31170 83 83 -
YWERNTQNAKRSEQSFRVNLRTALRYYNQS Q61642 80 80 -
YWERNTQNAKRSEQSFRVNLRTALRYYNQS Q64272 80 80 -
YWERETRRAKGNEQSFRVDLRTALRYYNQS HA12_MOUSE 83 83 -
YWERNTRRAKGHEQWFRVSLRNLLGYYNQS Q61892 83 83 -
YWERETRNLKDTAQYYRVSLNNVRGYYNQS Q9JHN5 79 79 -
YWEQETQNAKDHEQSFRVSLRNLLGYYNQS HA14_MOUSE 80 80 -
YWDEETGKVKAQSQTDRENLRIALRYYNQS Q29689 83 83 -
YWDRQTERAKNTALSFRVNLQTLRGYYNQS Q30849 80 80 -
YWHQETQRTKDTAQFFRVYLNTLRGYYNQS Q30290 83 83 -
YWERETRNLKDTAQTYRVSLNNLRGYYNQS Q9JHN7 79 79 -
YWEEQTLVAKGQELDYRVSLRNLLSYYNQS HA11_RAT 83 83 -
YWERETQIAKGNEQSFRVDLRTLLRYYNQS Q95457 83 83 -
YWDEETGKVKAHSQTDRENLRIALRYYNQS 1A23_HUMAN 83 83 -
YWDEETGKVKAHSQTDRENLRIALRYYNQS Q9MY72 83 83 -
YWDEETGKVKAHSQTDRENLRIALRYYNQS Q9BCN1 83 83 -
YWDEETGKVKAHSQTDRENLRIALRYYNQS O15506 83 83 -
YWDEETGKVKAHSQTDRENLRIALRYYNQS 1A24_HUMAN 83 83 -
YWERNTRRAKGHEQSFRVSLRTLLGYYNQS Q61893 80 80 -
YWDRNTRIYKDTAQIFRVDLNTLRGYYNQS HA1B_BOVIN 86 86 -
YWDRNTRIYKDTAQTFRVYLNTLRGYYNQS O78186 80 80 -
YWDRETRTVKETAQRYRVDLDTLRGYYNQS O46882 83 83 -
YWDRETQNMKTATQTYQANLRTLLRYYNQS O02948 83 83 -
YWERNTRIAKDNEQSFRVNLRTLLGYYNQS Q61891 83 83 -
YWERETQISKSNAQTYRVDLNTLRGYYNQS Q9JHN4 79 79 -
YWDRETRISKENTLVYRGSLNNLRGYYNQS Q30289 83 83 -
YWERNTQIAKGNEQIFRVNLRTLLSYYNQS Q31169 83 83 -
YWDRETQISKETAQTYRVDLNTLRSYYNQS O19240 83 83 -
YWERETQRAKGNEQSFHVSLRTLLGHYNQS HA10_MOUSE 80 80 -
YWDRSTRIMKTATQNAPVGLRNLRGYYNQS Q30869 83 83 -
YWDRNTRIYKDTAQIFRANLNTALGYYNQS Q95395 83 83 -
YWDRNTRIYKDTAQIFRANLNTALGYYNQS Q95477 83 83 -
YWDRETQIQRDTSQTYRVDLKTLRGYYNQS O19243 83 83 -
YWDRETRNVKETAQTYGVGLNTLRGYYNQS O19244 80 80 -
YWDRETRNVKETAQTYGVGLNTLRGYYNQS Q31066 80 80 -
YWDRETRNVKETAQTYGVGLNTLRGYYNQS Q31067 80 80 -
YWEEETRKAKDITQFFRVGLGNLRGYYNQS Q9BCY8 83 83 -
YWDQETRSARDTAQTFRVNLKTLRGYYNQS Q30593 77 77 -
YWERETLMVKENEQVYRVSLRTLLRYYNQS O19445 80 80 -
YWERETLMVKENEQVYRVSLRTLLRYYNQS Q08680 80 80 -
YWDRETQISKENALWYREALNNLRGYYNQS O77977 80 80 -
YWEEQTQRAKSDEQWFRVSLRTAQRYYNQS HA1D_MOUSE 80 80 -
YWEEQTQRAKSDEQWFRVSLRTAQRYYNQS O35641 80 80 -
YWEEQTQRAKSDEQWFRVSLRTAQRYYNQS Q31191 68 68 -
YWEEQTQRAKSDEQWFRVSLRTAQRYYNQS Q31634 80 80 -
YWEEQTQRAKSDEQSFRGSLRTAQRYYNQS Q31148 80 80 -
YWERITRIAKESEQIYRVGLRTLRGYYNQS Q31267 80 80 -
YWERETQKSKGQKESFRVDLRTALRYYNQS Q31141 80 80 -
YWEEETRNTKAHAQTDRMNLQTLRGYYNQS Q9MYA2 83 83 -
YWERITQIAKGHEQWFRVSLRKLLGYYNQS Q31218 80 80 -
YWEEQTRRVKGHAQTFRVSLRNLRGYYNQS Q30713 80 80 -
YWERETQGAKGHEQVNRVNLRTLRGYYNQS Q31256 80 80 -
YWERETQGAKGHEQVNRVNLRTLRGYYNQS Q95577 80 80 -
YWERETRSVKGHAQTFRVNLNTLRGYYNQS Q95480 79 79 -
YWERETRNLKDTAQTYRVSLNTALRYYNQS Q9JHN3 79 79 -
YWEEETRRAKNNEQSFRFALRTLLGYYNQS Q95559 80 80 -
YWEEQTRRAKEGEQTFRVNLRTALHYYNQS P79588 80 80 -
YWDRETRNVMGSAQTDRVNLKTLRGYYNQS Q9TSW1 83 83 -
YWDRETRNVMGSAQTDRVNLKTLRGYYNQS Q9TSW2 83 83 -
YWDRETRISKENTLVYRGSLNNLRGYYNQS O77973 83 83 -
YWEEQTQRAKSDEQSFRGSLRTAQRYYNQS Q31614 80 80 -
YWERTTGYAKANAQTDRVALRNLLRRYNQS 1C28_PANTR 80 80 -
YWDRNTRNAMGNAQIYRGNLRTALGYYNQS O19245 83 83 -
YWERNTRISKEAAETYRVDLNNLRGYYNQS Q30481 83 83 -
YWDEETRNAMGSAQTFRVNLNNLRGYYNQS Q9TSW3 80 80 -
YWDEETRNAMGSAQTFRVNLNNLRGYYNQS Q9TSW4 80 80 -
YWERETQKAKGQEQWFRVSLRNLLGYYNQS HA11_MOUSE 83 83 -
YWDQQTQIAKDTAQTFRVNLNTALRYYNQS HA1A_RABIT 83 83 -
YWDQQTQIAKDTAQTFRVNLNTALRYYNQS HA1B_RABIT 83 83 -
YWDRETRSARDTAQIFRVNLRTLRGYYNQS Q9GIY8 80 80 -
YWEEQTRNTEAHAQNHRVCLRTVPGYYNQS Q9MXS4 83 83 -
YWDRETRISKENTLVYRGSLNNLRGYYNQS O77974 83 83 -
YWERETRISKENAQIFRVDLNNLRGYYNQS O98028 83 83 -
YWEEQTGLAKDITQSFRVGLGNLRGYYNQS Q9BCY5 80 80 -
YWDRNTRIYKDTAQTFRVYLNALRGYYNQS O77972 80 80 -
YWEWTTGYAKANAQTDRVALRNLLRRYNQS HLAF_HUMAN 80 80 -
YWEWTTGYAKANAQTDRVALRNLLRRYNQS Q9TP68 80 80 -
YWDRNTRNPKGNAQTFRVGLTILRGYYNQS Q30838 87 87 -
YWDPQTRTIKETARTFRVDLDTLRGYYNQS O46880 80 80 -
YWDEETRKVKDNAQTLRVGLNTLRGYYNQS O19241 80 80 -
YWDEETRKVKDNAQTLRVGLNTLRGYYNQS Q9TQ85 80 80 -
YWEQQTQIVKGHEWSFRVSLRNLLGYYNQS P79587 80 80 -
YWDRETRKQRDTSQTYRVGLKNLRGYYNQS O19075 80 80 -
YWERNTRIFKDTAQTFRVSLNNLRGYYNQS Q95479 83 83 -
YWERETRRVKENEQLFRGNLRTLLGYYNQS P79589 80 80 -
YWEQETQTAKGTAQTDRVDLNTLRGYYNQS Q9JHN6 79 79 -
YWERTTGYAKANARTDRVALRKLLLRYNQS HLAF_MACMU 82 82 -
YWRRETHRAKKNEQIFREKLRNLNGHYNQS P70466 83 83 -
YWDRETRSARDTAQIFRVNLRTLRGYYNQS HLAE_HUMAN 80 80 -
YWDRETRSARDTAQIFRVNLRTLRGYYNQS Q9GIY7 80 80 -
YWETQTRRAKGNEQIYRGSLTTLLHYYNQS Q31271 83 83 -
YWEEQTRRAKANAQADRMCLRTVPGYYNQS Q9BCY6 80 80 -
YWDRNTRKPMGNAQIYRGNLRTALGYYNQS Q31068 83 83 -
YWDRNTRKPMGNAQIYRGNLRTALGYYNQS Q31069 83 83 -
YWEENTRRAKGWEQIFRGNLRTLLSYYNQS Q95558 82 82 -
YWERQTRKVKEKEQIFRDNLRTLLRYYNQS Q9JHM2 80 80 -
YWDQETRNVKAQSQTDRVDLGTLRGYYNQS Q29840 83 83 -
YWEEETRMAKNSEQTARVNLRTALRYYNQS Q95560 79 79 -
YWERETWKARDMGRNFRVNLRTLLGYYNQS HA15_MOUSE 79 79 -
YWDRETRSARETAKIFRVNLRTVRAYYNQS Q30171 79 79 -
YWERETQIAKGHEQSFRGSLRTAQSYYNQS HA17_MOUSE 80 80 -
YWERETRGAKDWEQIFRVDLRTLLGYYNQS Q31246 82 82 -
YWETQTRRAKGNEQIYRGSLTTLLHYYNQS O77949 83 83 -
YWDRETRNMKNTAQIFRVDLNTMLRYYNQS Q95481 83 83 -
YWDRETRNMKNTAQIFRVDLNTMLRYYNQS Q95483 83 83 -
YWDRETRKVKNTAQIFRVDLNTLLRYYNQS Q95486 83 83 -
YWERETWKARDMGRNFRVNLRTLLGYYNQS O98032 79 79 -
YWEEQTRWAKDSAQNCRVSLNDLRGDWNHS Q30484 83 83 -
YWDRNTRIYLDTAQISRVNLNTFRRYYNQS Q30493 83 83 -
YWERETWKARDMGRNFRVNLRTLLGYYNQS Q31153 79 79 -
YWERETWKARDMGRNFRVNLRTLLGYYNQS Q9QYQ4 79 79 -
YWERETWKARDMGRNFRVNLRTLLGYYNQS Q9TQB1 79 79 -
YWDRNTRIYLDTAQIFRLNLQTALRYYNQS Q95487 83 83 -
YWEEETQRAAGLAHSFRGNLNNLRGYYNQS Q30486 83 83 -
YWERETQKAKGHEESFRVSLRTAQRYYNQS HA18_MOUSE 80 80 -
YWERETQKAKGHEESFRVSLRTAQRYYNQS P79567 80 80 -
YWERETQKAKGHEESFRVSLRTAQRYYNQS P79568 80 80 -
YWDRNTRIYLDTAQIFRVDLNTMLRYYNQS Q95482 83 83 -
YWERETQIAKDNEQSFGWSLRNLIHYYNQS O19440 80 80 -
YWERETRKARDTGRNFKVNLRTLLRYYNQS O78105 79 79 -
YWDEETQRAKDLVQNFRRNLMILRGYYNQS Q9TNZ1 78 78 -
YWERETRRAKGDEHMFRVSLRNLRGYYNQS Q05081 80 80 -
YWEEETRRIQETEQWFQMDLRTLRGYYNQN O77950 83 83 -
YWEEETRKARNTGKNFRLNLQTLLRYYNQS Q95557 78 78 -
YWDEETRISKDNAQTLRGNLNTLRGYYNQS Q9TSW5 80 80 -
YWDEETRISKDNAQTLRGNLNTLRGYYNQS Q9TSW6 80 80 -
YWERNTRRVKGSEKRFQESLSTLLSYYNQS O19441 80 80 -
YWERNTRRVKGSEKRFQESLSTLLSYYNQS Q31215 80 80 -
YWEEQTKIAKNNKQWFRGSLRTALNYYNQS Q31216 83 83 -
YWNGQTQIVQGNEQIIRENLGILQRRYNQT O46792 79 79 -
FWEEQTEIAKVHAQTSRSNLQTALGYYNQS O46881 83 83 -
YCDRNTRIYKDTSQNFQVSLNVLRGYYNQS Q9TNZ2 80 80 -
YWDSETQTSQRTEQIDRDGLGTLQRRYNQT Q9GIP6 79 79 -
YWDGQTQIGQLNEQINRENLGIRQRRYNQT O46790 79 79 -
YWDGQTQIGQGNEQIDRENLDILRRRYNQT O46788 79 79 -
YWARETEIVTSNAQFFRENLQTMLDYYNLS Q60678 85 85 -
YWERNTQIVQRNEQNSRVSLDNVARLYNQS Q95592 79 79 -
YWARETEIVTSNAQFFRENLQTMLEYYNLS Q95551 85 85 -
YWARETEIVTSNAQFFRENLQTMLDYYNLS HA1U_MOUSE 85 85 -
YWARETEIVTSNAQFFRENLQTMLDYYNLS Q31202 85 85 -
YWARETEIVTSNAQFFRENLQTMLDYYNLS HA1T_MOUSE 85 85 -
YWDRETQIVQGSEQINRENLDILRRRYNQT Q95601 79 79 -
YWDRETQRGQNNQQFYRCGLGTLRGRYNQS O62881 81 81 -
FWETQTKIAKAHAQKLSWNLRSTLRYCNQS Q9GJE3 80 80 -
YWEGQTQISRSNAQITRVGLETIRGYYNQS Q9TPK7 83 83 -
YWEGQTQISRSNAQITRVGLETIRGYYNQS Q9TPL0 83 83 -
YWDGQTQIEQHNEQIDRENLGTLQRRYNQT O46791 79 79 -
YWERNTQIVQRNEQIDRENLVTAARRYNQS Q9TQD4 79 79 -
YWDRQTDIAKEHSKASRSNLRVIIGNHNHS Q9TNZ3 83 83 -
YWDGQTQIGQGNEQIDRENLGILQRRYNQT HA1F_CHICK 80 80 -
YWDGQTQIGQGNEQIDRENLGILQRRYNQT O73904 79 79 -
YWDGQTQIGQGNEQIDRENLGILQRRYNQT Q31400 79 79 -
YWDGQTQIGQGNEQIDRENLGILQRRYNQT O46789 79 79 -
YWDDQTRIAKAAEQQIRVYFQKLRDYYNQS Q31204 90 90 -
YWKELKLKVKNIAQSARANLRTLLRYYNQS Q31093 83 83 -
YWDGQTQIGQGNERSVEVSLNTLQERYNQT O73901 79 79 -
YWKELKLKVKNIAQSARANLRTLHRYYNQS Q31166 83 83 -
YWERNTQRAQGNEQIDRESLVTLARLYNQS Q9TQD5 79 79 -
YWEELKLKVKSIAQRARARLRTLIRYYNQS Q62708 83 83 -
YWEELKLKVKSIAQRARARLRTLIRYYNQS Q9QYV4 83 83 -
YWEERTLNSRTCTQVLRRTLNEVSQDYSNQ Q30428 88 88 -
FWERQTWIHRATAQNYRVGLENLRGYFNQS Q30768 83 83 -
HWERYTQLLRGWQQTFKAELRHLQRHYNHS O19478 76 76 -
YWERETERARGTEPVERANVGIVMERLNQT P79458 79 79 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS O97985 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS O97986 65 65 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q95460 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q9BCU2 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q9BCU3 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q9BCU4 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q9BD49 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q9BD50 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q9NPL2 80 80 -
HWERYTQLLRGWQQMFKVELKRLQRHYNHS Q9TQB9 76 76 -
YWERNTQKARGSEQTGKVNIQTLMTRTNQS O46838 73 73 -
YWERQTQNARGAEQIGKVNIPILSERTNQS O46829 73 73 -
YWERQTQILRGWEQTGKVDIQTLMTRTNQS O46837 73 73 -
YWERQTQILRGWEQTGKVDIQTLMTRTNQS O46846 73 73 -
YWERNTQNLRGSEQTGKVDIQTLMTRTNQS O46847 73 73 -
YWERETQNLRGWEQGGKVNIQTLMTRTNQS O46828 73 73 -
YWERETQTLRGWEQTGKVDIQTLMTRTNQS O46817 73 73 -
YWERETQTLRGWEQTGKVDIQTLMTRTNQS O46830 73 73 -
YWNRGTQIQQGTQETYKVDMDTLLHRFNQT Q9GIW6 82 82 -
YWERETQNARGAEQWGKVNIPILSERTNQS O46836 73 73 -
YWERETQIARGAEQIGKVDIQTLMTRTNQS O46849 73 73 -
YWERQTQILRGAEQIGKVDIQTLMTRTNQS O46845 73 73 -
YWERETQNARGWEQGGKVDIQTLMTRTNQS O46818 73 73 -
YWESQTGILKGTQQTYKASIDIVKQRFNQS Q31499 78 78 -
YWERETQTLRGAEQIGKVNIPILSERTNQS O46843 73 73 -
YWERNTQNARGWEQWGKVNIPILSERTNQS O46841 73 73 -
YWDEETQIGRGAEAVSKHKYQTVMSRYNQT Q9TP98 76 76 -
YWNRQTQIRQGWQETFKVDMDTLMRRFNQT O62896 82 82 -
YWERNTQTLRGAEQIGKVNIPILSERTNQS O46835 73 73 -
YWERNTQTLRGAEQIGKVNIPILSERTNQS O46839 73 73 -
YWERETQNLRGAEQMGKVDIQTLMTRTNQS O46844 73 73 -
YWERETQNLRGAEQMGKVDIQTLMTRTNQS O46848 73 73 -
YWERETQKSKGNEATFKHNVKVAMDRFNQS Q9TPA6 77 77 -
YWESQTGNCKGQQQTFKANIDIVNQRFNQS Q9GJB8 78 78 -
YWESQTGNCKGQQQTFKANIDIVNQRFNQS Q9TNX1 78 78 -
YWERQTQIARGWEQTGKVDIQTLMTRTNQS O46840 73 73 -
YWERQTQIARGWEQTGKVDIQTLMTRTNQS O46885 73 73 -
YWERETQKSKGIEATFKHNVKVAMDRFNQS Q08546 77 77 -
HWDTQTQKAQGGERDFDWNLNRLPERYNKS Q9BCW3 78 78 -
YWERETQTLRGWEPWGKANIDILSKRTNQT Q9MX69 73 73 -
YWERNTQNARGWEQGGKVNIPIAMTRTNQS O46820 73 73 -
SYRTWTQRLLGWEQIGKVNIQTALSRTNQS O19481 78 78 -
YWERNTQNLRGSEQMGKVNIPILSERTNQS O46831 73 73 -
YWERETQNLRGSEQMGKVNIPILSERTNQS O46825 73 73 -
YWERNTQKARGWEQWGKVNIPILSERTNQS O46886 73 73 -
YWEKETQIAKGTEPAFKYNVKIAMDRFNQT Q9TPA1 77 77 -
YWERETQTARGWEQWGKVDIQTLMTRTNQS O46842 73 73 -
YWERETQTLRGWEQMGKVNIPIAMTRTNQS O46832 73 73 -
YWERNTQILRGSEQMGKVNIPILSERTNQS O46822 73 73 -
YWERETQKAKGDEAWFKHNVKVAMDRFNQS Q9TPA0 77 77 -
YWERNTQILRGSEQTGKAAIQILSERTNQS O46821 73 73 -
YWERNTQILRGWEQIGKVDIQTLMTRTNQS O46827 73 73 -
YWNTQTQISLGDQETYKVGVSNLMKRFNQT O62894 82 82 -
YWNTQTQISLGDQETYKVGVSNLMKRFNQT O62895 82 82 -
YWERNTQILRGWEQIGKVDIQTLMTRTNQS O46826 73 73 -
YWERNTQTARGSEQMGKVNIQTLMTRTNQS O46824 73 73 -
YWEKETQSRKEYEPVFKHNVKTAMDRFNQT Q9TPA2 77 77 -
YWDRQTQTLIGTHQSFKNNIQVAKERFNQT O97982 73 73 -
YWESQTGILKGTQQTYKASIDIVKQRFNQS Q9TNN8 78 78 -
YWERNTGIFKGSQQTFKANIDIAKQRFNQS Q9GIJ3 76 76 -
YWERNTGIFKGSQQTFKANIDIAKQRFNQS Q9GJB9 76 76 -
YWERNTQIYKGAEASLKHNVKIAMDRFNQT Q9TPA5 40 40 -
YWEQQKQVMKGTEPVFKHNVKTAMERFNQS Q9TPA4 77 77 -
YWERNTQILRGAEQIGKAAIQILSERTNQS O46823 73 73 -
YWERNTQKARGWEQMGKVNIPILSERTNQS O46819 73 73 -
YWERETQTLRGWEQTGKVNIPIAMTRTNQS O46834 73 73 -
YWERNTQNLRGWEQMGKVNIPIAMTRTNQS O46833 73 73 -
YWRGQTQGLKAHEPVFKHNVKTVMDRFNQT Q9TPA3 77 77 -
YWNRNTQIYAGNEPSFKENINIVKSRFNQT Q31387 73 73 -
YWDEETQIMRGAEAVSKHNVQTVMSRFNQT Q9TP99 76 76 -
YWDRNTQNAVQNQHVDARNLEILRERYNQS O98191 83 83 -
YWDRNTQNAVQNQHVDARNLEILRERYNQS O98192 83 83 -
DEKMITNTRKGHQQTFKASVEIVMQRFNQT Q9MX28 70 70 -
FWQRNTQIRSNMHQLFKNNINIAMERFNQT Q9XRX0 73 73 -
YFADETQVFTNRMKIFQLSLRNIQQYYNSS Q62585 77 77 -
YWEQQTQIAKGSEPVHKHDVKTAMDRFNQT Q9TPA7 77 77 -
YWESQTGIFKGAQQTFKANIDIVKQRFNQS Q9TNN4 78 78 -
YWDSQTQIGVGSQHVYARSLETLRERYNQS O98187 83 83 -
YWDRNTQINVGNQHVNARNLETLRERYNQS O98189 83 83 -
YWEKETSRVLELSQVERQVLRLMVKKNGHK O19443 83 83 -
AWARKKFLAQEREMTFKARIPILMSRANQS O19480 73 73 -
YWDRNTQINVGNQHWYARSLETLRDRYNQS O98188 83 83 -
YWNTQTQILQGAQETFKVGVDTLMQRFNQT Q9GIW7 82 82 -
YFTHETEVFTNRMKIFQLSLRNIRQYYNSS Q31129 72 72 -
YWDRNTQNAVGSQHVTARNLEILRERYNQS O98193 83 83 -
YWEQQVHKVKTQEQQSARNLMMLVRFYNKS Q31277 89 89 -
YWERNTGIFKGSQQTFKANIDIAKQRFNQS Q31594 76 76 -
YWERETGICKGTQQTFKANIDILKQRFNQS P79570 78 78 -
DWEQQTRIVTIQGQLSERNLMTLVHFYNKS Q31208 84 84 -
NWEQQTRIVTIQGQLSERNLMTLVHFYNKS Q31615 84 84 -
NWEQQTRIVTIQGQLSERNLMTLVHFYNKS Q9BCZ1 84 84 -
YLEGQTGGLQGQQQTFKANIGIAKQRFNQT O98272 77 77 -
YWERNTGNCKGSQQTFKASIDIVKQRFNQS Q9GJC2 76 76 -
DWEQQTHIVTIQGQLSERNLMTLVHFYNKS Q31206 84 84 -
YWERETGNKLGSQQTFKANIEIAKQRFNQT Q9XR30 76 76 -
YDEQQTNILLGYPEVFKNNIKVVMERFNQT Q31365 75 75 -
DEKMITNTRKGNQQTFKANVEIGMQRFNQT Q9GJC0 70 70 -
DEKMITNTRKGNQQTFKANVEIGMQRFNQT Q9TNW9 70 70 -
YWDTQSQIGVGHQQTFKVNIETAKQRFNQT Q9GJE4 79 79 -
YWESQTGIFKGDQQTFKANIDTAKQRFNQS Q9GJC1 78 78 -
DWEKESQLQRAREEIFLVTLKDIMDYYKDT Q9DBB7 77 77 -
DWEKESQLQRAREEIFLVTLKDIMDYYKDT ZA2G_MOUSE 77 77 -
DWKQDSQLQKAREDIFMETLKDIVEYYNDS O60386 82 82 -
DWKQDSQLQKAREDIFMETLKDIVEYYNDS ZA2G_HUMAN 79 79 -
LWLQLTQSLKGWDHMFIVDFWTIMDNHNHS Q9GL43 83 83 -
DWEKESQLQRAREEIFLVTLKDIMDYYEDS ZA2G_RAT 77 77 -
YLDRNTGNFLGSQQTYKGNIEILKPRFNQT O46706 79 79 -
LWLHLSQSLKGWDYMFIVDFWTIMGNYNHS HFE_MOUSE 87 87 -
LWLHLSQSLKGWDYMFIVDFWTIMGNYNHS Q9D754 87 87 -
YWEEETETCLEKQQAFKENIKITKDRFNQT Q9XR31 76 76 -
LWLQLSQSLKGWDHMFIVDFWTIMDNHNHS Q9GKZ0 83 83 -
LWLQLSQSLKGWDHMFIVDFWTIMDNHNHS Q9GL42 83 83 -
LWLQLSQSLKGWDHMFIVDFWTIMDNHNHS Q9GL41 83 83 -
MWLQLSQSLKGWDHMFTVDFWTIMENHNHS HFE_HUMAN 83 83 -
MWLQLSQSLKGWDHMFTVDFWTIMENHNHS O75929 83 83 -
YWERGTQSRNSKEHWFTVNTQIVMQRRNDT Q9TP04 82 82 -
FWELATQDVLKEKSFVTGIMNKLLHIYNDS O19442 83 83 -
YLDTQSQNAFGAQQIYKANIEIAKERFNQT O46705 79 79 -
LWLQLSQSLKGWDYMFIVDFWTIMGNYNHS HFE_RAT 88 88 -

Motif 2 width=17
Element Seqn Id St Int Rpt
GSHTLQRMYGCDLGPDG 1C12_HUMAN 115 2 -
GSHTLQRMYGCDLGPDG 1C13_HUMAN 115 2 -
GSHTLQWMYGCDLGPDG Q9TNR4 84 2 -
GSHTLQRMYGCDLGPDG Q9TNN7 115 2 -
GSHTLQRMYGCDLGPDG Q9TPX2 115 2 -
GSHTLQWMYGCDLGPDG O78179 115 2 -
GSHTLQWMYGCDLGPDG Q9MY34 115 2 -
GSHTLQRMYGCDLGPDG 1C04_HUMAN 115 2 -
GSHTLQWMYGCDLGPDG O78214 115 2 -
GSHTLQWMYGCDLGPDG Q29862 115 2 -
GSHTLQRMYGCDLGPDG O19617 115 2 -
GSHTLQRMYGCDLGPDG Q95463 115 2 -
GSHTLQRMYGCDLGPDG Q9GIK4 115 2 -
GSHTLQRMYGCDVGPDG Q31603 115 2 -
GSHTLQNMYGCDVGPDG Q29961 115 2 -
GSHTLQRMYGCDVGPDG Q29767 115 2 -
GSHTLQRMYGCDVGPDG 1B44_HUMAN 115 2 -
GSHTLQRMYGCDLGPDG 1C15_HUMAN 115 2 -
GSHTLQTMYGCDVGPDG Q9MXM0 115 2 -
GSHTLQNMYGCDVGPDG 1B19_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG P79490 115 2 -
GSHTLQSMYGCDVGPDG Q9UIP6 115 2 -
GSHTLQRMYGCDVGPDG 1B11_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG Q95343 115 2 -
GSHTLQRMYGCDVGPDG Q9MYC0 115 2 -
GSHTLQSMYGCDVGPDG 1B39_HUMAN 115 2 -
GSHTLQSMYGCDVGPDG P79489 115 2 -
GSHTLQSMYGCDVGPDG P79555 115 2 -
GSHTLQSMYGCDVGPDG Q29848 115 2 -
GSHTFQRMYGCDVGPDG 1C01_GORGO 115 2 -
GSHTLQWMYGCDLGPDG Q31627 115 2 -
GSHTLQRMYGCDVGPDG Q9BD06 115 2 -
GSHTLQSMYGCDVGPDG 1B02_HUMAN 115 2 -
GSHTWQRMYGCDVGPDG 1B38_HUMAN 115 2 -
GSHTLQSMYGCDVGPDG Q29638 115 2 -
GSHTLQRMYGCDVGPDG Q08173 115 2 -
GSHTFQRMYGCDLGPDG 1C11_HUMAN 115 2 -
GSHTFQRMYGCDLGPDG Q9TQP9 115 2 -
GSHTFQRMYGCDLGPDG Q29652 115 2 -
GSHTLQSMYGCDLGPDG 1C02_GORGO 115 2 -
GSHTLQSMYGCDLGPDG 1C04_GORGO 115 2 -
GSHTLQSMYGCDVGPDG Q29854 115 2 -
GSHTLQSMYGCDVGPDG Q31610 115 2 -
GSHTLQSMYGCDVGPDG Q31613 115 2 -
GSHTLQSMYGCDVGPDG 1B34_HUMAN 115 2 -
GSHTLQSMYGCDVGPDG 1B46_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG Q9MXC8 115 2 -
GSHTLQSMYGCDVGPDG Q30173 115 2 -
GSHTLQWMYGCDLGPDG 1C16_HUMAN 115 2 -
GSHTLQWMYGCDLGPDG O78211 115 2 -
GSHTLQWMYGCDLGPDG Q29963 115 2 -
GSHTWQRMYGCDLGPDG 1B48_HUMAN 115 2 -
GSHTWQRMYGCDLGPDG Q9GIZ0 115 2 -
GSHTLQRMYGCDVGPDG Q29982 115 2 -
GSHTLQSMYGCDVGPDG Q29681 115 2 -
GSHTLQSMYGCDVGPDG Q29861 115 2 -
GSHTLQSMYGCDVGPDG 1B04_HUMAN 115 2 -
GSHTLQWMCGCDLGPDG 1C02_HUMAN 115 2 -
GSHTLQTMFGCDVGPDG Q9MXH3 115 2 -
GSHTLQRMYGCDVGPDG Q29943 115 2 -
GSHTLQNMYGCDVGPDG Q29693 115 2 -
GSHTLQSMYGCDVGPDG 1B36_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG P79549 115 2 -
GSHTLQRMYGCDVGPDG Q29981 115 2 -
GSHTLQRMYGCDVGPDG O19790 115 2 -
GSHTIQTMYGCDVGPDG Q9MXH4 115 2 -
GSHTLQWMYGCDLGPDG Q9MXC9 115 2 -
GSHTLQRMYGCDLGPDG 1C03_HUMAN 115 2 -
GSHTLQWMFGCDLGPDG 1C17_HUMAN 115 2 -
GSHTLQWMFGCDLGPDG O78178 115 2 -
GSHTLQWMFGCDLGPDG Q29641 115 2 -
GSHTLQWMFGCDLGPDG Q30192 115 2 -
GSHTLQRMYGCDLGPDG 1C14_HUMAN 115 2 -
GSHTLQRMYGCDLGPDG 1B59_HUMAN 115 2 -
GSHTWQTMYGCDVGPDG Q9MXI1 115 2 -
GSHTWQTMYGCDVGPDG Q9MXK3 115 2 -
GSHTLQRMYGCDVGPDG 1B32_HUMAN 115 2 -
GSHTLQNMYGCDVGPDG Q29705 115 2 -
GSHTLQNMYGCDVGPDG 1B14_HUMAN 115 2 -
GSHTLQNMYGCDVGPDG 1B18_HUMAN 115 2 -
GSHTLQNMYGCDVGPDG O78189 115 2 -
GSHIIQRMYGCDVGPDG Q29748 115 2 -
GSHTLQSMYGCDLGPDG Q9MXL6 115 2 -
GSHTLQWMCGCDLGPDG Q9UQS9 115 2 -
GSHTLQWMCGCDLGPDG O02865 115 2 -
GSHTLQRMYGCDVGPDG Q29836 115 2 -
GSHTLQSMYGCDVGPDG Q29855 115 2 -
GSHTLQSMYGCDVGPDG Q9TPW6 115 2 -
GSHTLQSMYGCDVGPDG Q9MXK4 115 2 -
GSHTIQRMYGCDVGPDG 1A34_HUMAN 115 2 -
GSHTLQSMYGCDLGPDG Q9MXD0 115 2 -
GSHIIQRMYGCDMGPDG 1B02_PANTR 115 2 -
GSHIIQRMYGCDMGPDG Q9MXK0 115 2 -
GSHTLQNMYGCDVGPDG Q29846 115 2 -
GSHTLQSMYGCDVGPDG P79612 115 2 -
GSHIIQRMYGCDLGPDG Q29864 115 2 -
GSHTLQWMYGCDVGPDG 1B07_HUMAN 115 2 -
GSHTLQWMYGCDVGPDG 1B08_HUMAN 115 2 -
GSHTLQWMYGCDLGPDG Q29959 115 2 -
GSHTLQWMYGCDLGPDG Q29960 115 2 -
GSHTLQTMYGCDVGPDG Q9MXH2 115 2 -
GSHTWQTMYGCDVGPDG Q29842 115 2 -
GSHTLQKMYGCDLGPDG O46684 115 2 -
GSHTLQKMYGCDLGPDG Q9MXD2 115 2 -
GSHTLQKMYGCDLGPDG Q9TPL2 115 2 -
GSHTLQRMSGCDLGPDG O78083 115 2 -
GSHTLQRMSGCDLGPDG Q95603 115 2 -
GSHTLQRMYGCDVGPDG Q29749 115 2 -
GSHTLQTMYGCDVGPDG Q9MXH5 115 2 -
GSHTWQRMYGCDVGPDG Q9XRY3 115 2 -
GSHTLQSMYGCDLGPDG Q9MXC6 115 2 -
GSHTLQSMYGCDLGPDG Q9MXG6 115 2 -
GSHTWQTMYGCDVGPDG Q9MXI2 115 2 -
GSHTWQTMYGCDVGPDG Q9TPL5 115 2 -
GSHTWQTMFGCDVGPDG Q9MXL9 115 2 -
GSHTLQSMYGCDLGPDG Q9MXL7 115 2 -
GSHIIQRMYGCDVGPDG 1B10_HUMAN 115 2 -
GSHTLQSMYGCDVGPDG 1B20_HUMAN 91 2 -
GSHTLQRMYGCDVGPDG 1B31_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG Q29847 115 2 -
GSHTLQRMFGCDLGPDG 1C07_HUMAN 115 2 -
GSHTLQRMFGCDLGPDG Q29921 115 2 -
GSHTLQRMFGCDLGPDG Q29865 115 2 -
GSHTLQRMFGCDLGPDG P79498 115 2 -
GSHTIQRMSGCDVGPDG 1B29_HUMAN 115 2 -
GSHTWQTMYGCDVGPDG Q9MXM1 115 2 -
GSHTLQRMFGCDVGPDG 1B45_HUMAN 115 2 -
GSHTLQRMFGCDVGPDG Q9GIL3 115 2 -
GSHTWQTMYGCDVGPDG 1B12_HUMAN 115 2 -
GSHIIQRMYGCDVGPDG Q29844 115 2 -
GSHTLQRMYGCDVGPDG Q30172 115 2 -
GSHIIQRMYGCDVGPDG Q9TP95 115 2 -
GSHTLQTMYGCDVGPDG Q9MXH1 115 2 -
GSHTLQRMYGCDVGPDG Q29852 115 2 -
GSHTLQRMSGCDLGPDG 1CXX_HUMAN 91 2 -
GSHTWQTMFGCDVGPDG Q9MXH0 115 2 -
GSHTIQRMYGCDVGPDG 1A66_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG Q9BCM6 115 2 -
GSHTIQRMYGCDVGPDG P79563 115 2 -
GSHTLQNMYGCDVGPDG 1B15_HUMAN 115 2 -
GSHTLQSMYGCDLGPDG 1B25_HUMAN 115 2 -
GSHTLQWMCGCDLGPDG 1C01_HUMAN 115 2 -
GSHIIQRMYGCDVGPDG Q29992 115 2 -
GSHTLQRMYGCDVGPDG 1B13_HUMAN 115 2 -
GSHTLQSMYGCDLGPDG 1C03_GORGO 115 2 -
GSHTWQTMYGCDLGPDG 1B55_HUMAN 115 2 -
GSHTWQTMYGCDLGPDG 1B56_HUMAN 115 2 -
GSHTWQTMYGCDLGPDG 1B57_HUMAN 115 2 -
GSHTWQTMYGCDLGPDG P79523 115 2 -
GSHILQRMYGCDVGPDG 1C06_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG O19554 115 2 -
GSHTWQRMYGCDLGPDG 1B43_HUMAN 115 2 -
GSHTWQRMYGCDLGPDG O78172 115 2 -
GSHTLQSMYGCDVGPDG Q29637 115 2 -
GSHTLQRMYGCDVGPDG Q31602 115 2 -
GSHTLQRMYGCDVGPDG Q9GIX2 115 2 -
RSHTLQRMYGCDVGPDG Q9GIK8 115 2 -
GSHTIQRMYGCDVGPDG 1A26_HUMAN 115 2 -
GSHTIQRMYGCDVGPDG Q95377 115 2 -
GSHTIQRMYGCDVGPDG Q9MY52 115 2 -
GSHIIQRMYGCDLGPDG 1B35_HUMAN 115 2 -
GSHIIQRMYGCDLGPDG Q31605 115 2 -
GSHTIQIMYGCDVGPDG Q29747 115 2 -
GSHTWQTMYGCDLGPDG 1B58_HUMAN 115 2 -
GSHIIQRMYGCDVGPDG Q9BCM7 115 2 -
GSHTLQSMYGCDLGPDG Q9TPL4 115 2 -
GSHTIQRMYGCDLGPDG Q95604 115 2 -
GSHTLQNMYGCDVGPDG 1B16_HUMAN 115 2 -
GSHIIQRMYGCDVGPDG O78218 115 2 -
GSHTWQRMYGCDLGPDG 1B47_HUMAN 115 2 -
GSHIIQRMYGCDLGPDG 1C18_HUMAN 115 2 -
GSHIIQRMYGCDLGPDG O78165 115 2 -
GSHIIQRMYGCDLGPDG Q29644 115 2 -
GSHTIQMMYGCDVGPDG 1A74_HUMAN 115 2 -
GSHTLQRMYGCDLGPDG Q9TNR1 91 2 -
GSHIIQRMYGCDVGPDG 1C05_HUMAN 115 2 -
GSHTLQRMYGCDVGPDG Q29932 115 2 -
GSHTLQNMYGCDVGPDG Q29845 115 2 -
GSHTIQRMYGCDVGPDG Q9MW42 115 2 -
GSHTIQIMYGCDVGSDG Q9MXK9 115 2 -
GSHIIQRMYGCDMGPDG 1A02_PANTR 115 2 -
GSHIIQRMYGCDMGPDG Q9MXI3 115 2 -
GSHTIQRMFGCDVGPDG 1B01_GORGO 115 2 -
GSHIIQRMYGCDLGPDG 1B22_HUMAN 115 2 -
GSHIIQRMYGCDLGPDG O19755 115 2 -
GSHIIQRMYGCDLGPDG Q29669 115 2 -
GSHTIQIMYGCDVGPDG 1A11_HUMAN 115 2 -
GSHTIQIMYGCDVGPDG Q9BCN0 115 2 -
GSHTIQIMYGCDVGPDG Q9MYI5 115 2 -
GSHTIQIMYGCDVGPDG Q9TQP6 115 2 -
GSHTIQIMYGCDVGPDG Q9TQP7 115 2 -
GSHTWQTMYGCDVGPDG Q29858 115 2 -
GSHIIQRMYGCDLGPDG 1B23_HUMAN 115 2 -
GSHTLQSMYGCDLGPDG Q9MXC7 115 2 -
GSHTLQSMYGCDLGPDG Q9MXG5 115 2 -
GSHTLQRMSGCDVGPDG Q29697 115 2 -
GSHTIQWMYGCDMGPDG 1B03_GORGO 115 2 -
GSHTWQTMFGCDVGPDG Q9MXD1 115 2 -
GSHIIQRMYGCDLGPDG Q29700 115 2 -
GSHTLQSMYGCDMGPDG Q9MXK1 115 2 -
GSHTLQRMYGCDVGPDG Q29935 115 2 -
GSHTIQRMYGCDVGSDG 1A03_GORGO 115 2 -
GSHIIQRMYGCDLGPDG 1B21_HUMAN 115 2 -
GSHIIQRMYGCDLGPDG 1B27_HUMAN 115 2 -
GSHIIQRMYGCDLGPDG 1B28_HUMAN 115 2 -
GSHIIQRMYGCDLGPDG Q9MY33 115 2 -
GSHIIQRMYGCDLGPDG 1B26_HUMAN 115 2 -
GSHTFQRMFGCDVGPDG 1B02_GORGO 115 2 -
GSHTLQTMYGCDMGPDG Q9MXH7 115 2 -
GSHTLQRMYGCDVGPDG Q29633 115 2 -
GSHTLQRMYGCDVGPDG Q29985 115 2 -
GSHTIQRMYGCDMGPDG 1B04_GORGO 115 2 -
GSHIIQRMYGCDVGPDG Q29911 115 2 -
GSHIIQRMYGCDLGPDG Q29991 115 2 -
GSHTWQTMFGCDVGPDG Q9MXI0 115 2 -
GSHTIQIMYGCDVGSDG 1A30_HUMAN 115 2 -
GSHTWQTMYGCDVGPDG 1B63_HUMAN 115 2 -
GSHTIQRMYGCDVGPDG 1A25_HUMAN 115 2 -
GSHTIQIMYGCDVGSDG 1A01_PANTR 115 2 -
GSHIIQRMYGCDVGPDG Q9MXH6 115 2 -
GSHTWQTMYGCDLGPDG O78180 115 2 -
GSHTIQRMYGCDVGPDG 1A43_HUMAN 115 2 -
GSHTIQIMYGCDVGSDG Q9TPL7 115 2 -
GSHTIQKMYGCDVGSDG 1A02_GORGO 115 2 -
GSHTIQIMYGCDVGSDG Q9MXM7 115 2 -
GSHTLQRMYGCDVGPDG Q95365 115 2 -
GSHTWQTMYGCDVGPDG Q29924 115 2 -
GSHTIQIMYGCDVGSDG 1A03_PANTR 115 2 -
GSHTWQTMFGCDVGPDG Q9MXK5 115 2 -
GSHTWQTMYGCDLGPDG 1B05_HUMAN 115 2 -
GSHTLQRMFGCDLGPDG Q9MYB8 115 2 -
GSHIIQRMYGCDVGPDG 1B41_HUMAN 115 2 -
GSHIIQRMYGCDVGPDG 1B42_HUMAN 115 2 -
GSHIIQRMYGCDVGPDG P79524 115 2 -
GSHIIQRMYGCDVGPDG Q29850 115 2 -
GSHTWQTMYGCDLGPDG Q29661 115 2 -
GSHTWQTMYGCDVGPDG Q29857 115 2 -
GSHTIQRMYGCDVGTDG O19446 115 2 -
GSHTIQRMYGCDVGTDG Q31266 105 2 -
GSHALQTMYGCDVGPDG Q9MXM2 115 2 -
GSHTWQTMYGCDMGPDG Q31612 115 2 -
GSHTWQRMYGCDVGPDG Q9XRX9 115 2 -
GSHTLQWMYGCDLGPDG Q30719 115 2 -
GSHTIQRMYGCDVGSDG 1A01_GORGO 115 2 -
GSHTLQRMYGCDLGPDG Q30720 112 2 -
GSHTWQTMYGCDMGPDG Q9MXJ9 115 2 -
GSHTIQMMYGCDVGPDG 1A32_HUMAN 115 2 -
GSHTIQMMYGCDVGPDG Q9GJ44 115 2 -
GSHTIQMMYGCDVGPDG Q9GJ45 115 2 -
RSHIIQRMYGCDVGPDG Q29993 115 2 -
GSHTIQRMFGCDLGPDG Q9MXG3 115 2 -
GSHIIQRMYGCDVGPDG Q9MYC3 115 2 -
GSHTIQIMYGCDVGPDG 1A36_HUMAN 115 2 -
GSHTLQRMYGCDLGPDG Q9TNR2 91 2 -
GSHTIQMMYGCDVGSDG 1A31_HUMAN 115 2 -
GSHIIQRMYGCDVGPDG Q9UQS8 115 2 -
GSHTWQRMYGCDLGPDG Q29941 115 2 -
GSHTYQWMYGCDVGPDG Q30712 115 2 -
GSHTLQTMYGCDVGPDG Q9MXM4 115 2 -
GSHTIQMMYGCDVGSDG 1A68_HUMAN 115 2 -
GSHTIQRMFGCDVGPDG 1A01_PONPY 115 2 -
GSHTWQTMYGCDLGPDG Q29940 115 2 -
GSHTIQLMFGCDVGSDG 1A04_PANTR 115 2 -
GSHTIQMMYGCDVGPDG Q9MYG5 115 2 -
GSHTWQTMYGCDVGPDG Q9TPL6 115 2 -
GSHTLQTMYGCDMGPDG Q9MXH8 115 2 -
GSHTLQTMYGCDLGPDG Q30711 112 2 -
GSHTLQTMYGCDLGPDG Q30716 115 2 -
GSHTLQTMYGCDMGPDG Q9MXH9 115 2 -
GSHTIQMMYGCDVGSDG Q9UIN2 115 2 -
GSHIIQRMYGCDVGPDG Q29849 115 2 -
GSHTIQWMYGCDLGPDG 1A01_SAGOE 115 2 -
GSHTWQTMYGCDVGPDG 1B53_HUMAN 115 2 -
GSHTIQAMYGCDVGPDG Q30287 90 2 -
GSHTIQLMFGCDVGSDG Q9MXL0 115 2 -
GSHTIQIMYGCDVGSDG 1A03_HUMAN 120 2 -
GSHTIQIMYGCDVGSDG Q9MYG4 115 2 -
GSHTIQIMYGCDVGSDG O19756 115 2 -
GSHTFQWMYGCDVGPDG Q95394 115 2 -
GSHTLQWMYGCDLGPDG Q29925 115 2 -
GSHIIQRMYGCDLGPDG 1B54_HUMAN 115 2 -
GSHTIQLMFGCDVGSDG Q9MXI8 115 2 -
GSHTIQLMFGCDVGSDG Q9TPL3 115 2 -
GSHTWQTMFGCDMGPDG Q30988 115 2 -
GSHTVQRMYGCDVGSDW Q9TQB6 115 2 -
GSHTWQTMYGCDVGPDG Q29938 115 2 -
GSHTLQRMFGCDLGPDG Q29718 115 2 -
GSHTIQMMYGCDVGSDG 1A33_HUMAN 115 2 -
GSHTWQTMYGCDVGPDG 1B49_HUMAN 115 2 -
GSHTWQTMYGCDVGPDG O78173 115 2 -
GSHTLQTMYGCDVGPDG Q9MXM3 115 2 -
GSHTWQTMYGCDLGPDG Q9GIY5 115 2 -
GSHTIQRMYGCDVGPDG Q9BD51 115 2 -
GSHTIQRMYGCDLGPDG Q30718 115 2 -
GSHTIQWMYGCDMGPDG Q9MWK4 115 2 -
GSHTFQTMYGCDLGPDG Q9GJ78 115 2 -
GSHIIQRMYGCDVGPDG 1B52_HUMAN 115 2 -
GSHTLQWMYGCDVGPDG Q30482 112 2 -
GSHTIQMMYGCHVGSDG 1A29_HUMAN 115 2 -
GSHTIQIMFGCDVGSDG Q9MXK7 115 2 -
GSHTLQMMHGCDLGPDG Q30595 112 2 -
GSHTIQRMYGCEVGPDG 1OKO_GORGO 115 2 -
GSHIIQRMYGCDLGPDG 1B62_HUMAN 115 2 -
GSHTIQIMYGCDVGSDG Q30900 115 2 -
GSHIIQVMYGCDVGPDG 1B61_HUMAN 115 2 -
GSHIIQVMYGCDVGPDG P79496 115 2 -
GSHIIQRMYGCHVGPDG Q29988 115 2 -
GSHTWQTMYGCDMGPDG Q9MXL8 115 2 -
GSHTIQIMYGCDVGSDG Q9MXM6 115 2 -
GSHTIQRMYGCDVGSDG 1A04_GORGO 115 2 -
GSHIIQVMYGCDVGPDG 1B60_HUMAN 115 2 -
GSHIIQVMYGCDVGPDG Q9MYI6 115 2 -
GSHTLQTMHGCDLGPDG Q30868 115 2 -
GSHTIQVMYGCDVGSDG Q31142 112 2 -
GSHTLQTMLGCDLGPDG Q9BCY9 115 2 -
GSHTLQWMYGCDLGPDG 1C01_PANTR 115 2 -
GSHTIQIMYGCDVGSDG Q9MXM5 115 2 -
GSHTMQVMYGCDVGPDG HLAH_HUMAN 115 2 -
GSHTIQLMYGCDVGSDG Q9MXI6 115 2 -
GSHTVQRMYGCDVGSDW 1A02_HUMAN 115 2 -
GSHTVQRMYGCDVGSDW O78126 112 2 -
GSHTVQRMYGCDVGSDW P79603 115 2 -
GSHTVQRMYGCDVGSDW Q9MYB7 115 2 -
GSHTVQRMYGCDVGSDW Q9TQ73 115 2 -
GSHTWQSMYGCYVGPDG Q9XRY2 115 2 -
GSHTIQLMFGCDVGSDG Q9MXL4 115 2 -
GSHTYQWMAGCDVGPDG Q30871 115 2 -
GSHTYQWMAGCDVGPDG Q9BCY7 115 2 -
GSHTIQYMYGCDVGPDG Q30485 112 2 -
GFHTIQWMYGCDLGPDG 1C01_SAGOE 115 2 -
GSHTIQIMYGCDVGSDG 1A80_HUMAN 115 2 -
GSHTIQLMFGCDVGSDG Q9MXJ2 115 2 -
GSHTLQVMYGCDVGSDW Q31172 112 2 -
GSHTFQRMVGCDLGPDG Q9MXS5 115 2 -
GSHTLQKMCGCDVGPDG Q9MXQ3 115 2 -
GSHTIQIMFGCDVGSDG Q30901 115 2 -
GSHTVQEMYGCDVGPDG O77975 112 2 -
GSHTFQRMVGCDLGPDG Q30591 87 2 -
GSHTIQEMYGCDVGSDG HA12_RAT 115 2 -
GTHTLQWMYGCDVGSDG Q31196 110 2 -
GSHTIQIMYGCDVGPDG 1A01_HUMAN 115 2 -
GSHTLQRMVGCDLGPDG Q9TNR3 91 2 -
GSHTIQMMSGCDLGPDG 1B01_SAGOE 115 2 -
GTHTLQWMYGCDVGSDG HA1L_MOUSE 115 2 -
GSHTIQRMYGCDVGPDG Q9BD53 115 2 -
GSHTIQEMFGCDVGSDG Q31254 112 2 -
GSHTVQRMSGCDVGSDW Q9TQ65 115 2 -
GSHTVQRMCGCDVGSDW Q29757 115 2 -
GSHTLQKMCGCDLGPDG Q9MXR5 115 2 -
GSHTLQKMCGCDLGPDG Q9MXS3 115 2 -
GSHTLQEMYGCDVGSDG Q30291 112 2 -
GSHTLQWMYGCDLGPDG Q30715 115 2 -
GSHTLQDMYGCDVGPDG Q9GIW5 115 2 -
GSHTLQMMFGCDVGSDG Q9TQ74 115 2 -
GSHTIQRMYGCDLGPDG Q30870 115 2 -
GSHTIQRMYGCDLGPDG Q9BCZ0 115 2 -
GSHTVQWMHGCDLGPDG Q30714 47 2 -
GSHTLQWMSGCDVGPDG HA1A_BOVIN 112 2 -
GSHTSQRMFGCDLGPDG Q9TNR0 91 2 -
GSHTIQRMYGCDVGSDW Q31149 115 2 -
GSHTLQSMYGCDVGPDG O19242 112 2 -
GSHNIQAMYGCDVGSDG Q95393 112 2 -
GSHTYQVMYGCDLGPDG Q30592 87 2 -
GSHTIQRMYGCDVGSDG Q31255 112 2 -
GSHTIQRLSGCDVGSDW HA13_MOUSE 115 2 -
GSHTLQWMHGCDLGPDG Q9BCY4 109 2 -
GSHTLQMMFGCDVGSDG Q29907 115 2 -
GSHTFQRMYGCEVGSDW HA1K_MOUSE 112 2 -
GSHTFQRMYGCEVGSDW Q95458 112 2 -
GSHTFQRMYGCDLGSDW Q31188 115 2 -
GSHTIQLMFGCDVGSDG Q9MXK6 115 2 -
GSHTIQRMYGCDVGSDG HA1W_MOUSE 112 2 -
GSHTFQRMYGCEVGSDW Q31173 112 2 -
GSHTLQRMSGCDVGPDG Q9BD52 115 2 -
GSHTFQWMSGCDVGPDG Q30483 112 2 -
GSHTIQVISGCEVGSDG HA1B_MOUSE 112 2 -
GSHTIQRMSGCDVGSDW Q61895 112 2 -
SSHTLQWMIGCDLGSDG HLAG_HUMAN 115 2 -
SSHTLQWMIGCDLGSDG Q9TP69 112 2 -
SSHTLQWMIGCDLGSDG Q30182 115 2 -
GSHTIQWMYGCKVGSDG Q31214 115 2 -
GSHTLQWMYGCDVGSDG Q61896 112 2 -
GSHTLQKMCGCDLGPDG Q30721 115 2 -
GSHTRQTMYGCDLGPDG HA19_CANFA 115 2 -
GSHTLQWMYGCDVGSDG Q31155 115 2 -
GSHTFQGMYGCEVGSDW Q61894 112 2 -
GSHTLQLMYGCDVGPDG O77976 112 2 -
GSHTLQRMYGCDVGPDG Q30488 111 2 -
GSHTVQVMSGCDVGSDG Q31170 115 2 -
GSHTIQRMYGCDVGSDW Q61642 112 2 -
GSHTIQRMYGCDVGSDR Q64272 112 2 -
GSHTLQWMAGCDVESDG HA12_MOUSE 115 2 -
GSHTLQWMSGCDVGSDG Q61892 115 2 -
GSHTLQRMYGCDVGTEG Q9JHN5 111 2 -
GSHTIQGMRGCDVGSDW HA14_MOUSE 112 2 -
GSHTLQMMFGCDVGSDG Q29689 115 2 -
GSHTLQWMYGCEVGADG Q30849 112 2 -
GSHTVQEMYGCDVGPDG Q30290 115 2 -
GSHTYQRMYGCEVGTEG Q9JHN7 111 2 -
GSHTIQRMYGCDVGSDG HA11_RAT 115 2 -
GSHTIQRLSGCDVGSDW Q95457 115 2 -
GSHTLQMMFGCDVGSDG 1A23_HUMAN 115 2 -
GSHTLQMMFGCDVGSDG Q9MY72 115 2 -
GSHTLQMMFGCDVGSDG Q9BCN1 115 2 -
GSHTLQMMFGCDVGSDG O15506 115 2 -
GSHTLQMMFGCDVGSDG 1A24_HUMAN 115 2 -
GSHTLQQMYGCEVGSDG Q61893 112 2 -
GSHNIQAMYGCDVGPDG HA1B_BOVIN 118 2 -
GSHTLQWMSGCDVGPDG O78186 112 2 -
GSHTRQTMYGCDLGPGG O46882 115 2 -
GSHTFQKMYGCDLGPDG O02948 115 2 -
GSHTLQRLSGCDVGSDG Q61891 115 2 -
GSHTYQRMYGCEVGTEG Q9JHN4 111 2 -
GSHTFQQMFGCDVGPDG Q30289 115 2 -
GSHTIQWMFGCDVESDG Q31169 115 2 -
GSHTLQSMYGCDVGPDG O19240 115 2 -
GSHTIQWMYGCKVGSDG HA10_MOUSE 112 2 -
GSHTYQSMYGCDLGPDG Q30869 115 2 -
GSHTFQEMYGCYVGPDG Q95395 115 2 -
GSHTFQEMYGCYVGPDG Q95477 115 2 -
GSHTLQSMYGCYLGPDG O19243 115 2 -
GSHTLQSMYGCYLGPDG O19244 112 2 -
GSHTLQSMYGCYLGPDG Q31066 112 2 -
GSHTLQSMYGCYLGPDG Q31067 112 2 -
GSHTFQWMAGCDLGSDG Q9BCY8 115 2 -
ASHTLQWMHGCDLGPDG Q30593 109 2 -
GSHTIQWMSGCDVGSDG O19445 112 2 -
GSHTIQWMSGCDVGSDG Q08680 112 2 -
GSHTYQRMYGCDVGPDG O77977 112 2 -
GSHTFQRMFGCDVGSDW HA1D_MOUSE 112 2 -
GSHTFQRMFGCDVGSDW O35641 112 2 -
GSHTFQRMFGCDVGSDW Q31191 100 2 -
GSHTFQRMFGCDVGSDW Q31634 112 2 -
GSHTIQRMFGCDVGSDW Q31148 112 2 -
GSHTIQRLSGCEVGSDG Q31267 112 2 -
GSHTLQVMYGCDVGSDW Q31141 112 2 -
SSHTLQWMIGCDLGSDG Q9MYA2 115 2 -
GSHTLQEMYGCDVGSDG Q31218 112 2 -
GSHTLQRMSGCYVEPDG Q30713 112 2 -
GSHTIQVMFGCDVGTDW Q31256 112 2 -
GSHTIQVMFGCDVGTDW Q95577 112 2 -
GSHTLQLMYGCDVRPHG Q95480 111 2 -
GSHTLQTMYGCDVGTEG Q9JHN3 111 2 -
GSHTIQWMSGCDVGSDG Q95559 112 2 -
RSHTIQRLSGCDVGSDG P79588 112 2 -
GSHTIQSMYGCDVGPDG Q9TSW1 115 2 -
GSHTIQSMYGCDVGPDG Q9TSW2 115 2 -
GSHTYQDMYGCDVGPDG O77973 115 2 -
GSHTIQRMFGCDVGSDW Q31614 112 2 -
GSHTLQGMNGCDMGPDG 1C28_PANTR 112 2 -
GSHTIQIMYGCDVGPDG O19245 115 2 -
GSHTIQDMYGCDVGPDG Q30481 115 2 -
GSHTFQSMYGCDVGPDG Q9TSW3 112 2 -
GSHTFQSMYGCDVGPDG Q9TSW4 112 2 -
GSHTLQQMSGCDLGSDW HA11_MOUSE 115 2 -
GSHTFQTMFGCEVWADG HA1A_RABIT 115 2 -
GSHTFQTMFGCEVWADG HA1B_RABIT 115 2 -
GSHTLQWMHGCELGPDG Q9GIY8 112 2 -
GSHTLQRMFGCDLGPDG Q9MXS4 115 2 -
GSHTFQLMYGCDVGPDG O77974 115 2 -
DSHTLQWMHGCDVGPDG O98028 115 2 -
GSHTLQWIYGCDLGPDG Q9BCY5 112 2 -
GSHTLQWMSGCDVGPDG O77972 112 2 -
GSHTLQGMNGCDMGPDG HLAF_HUMAN 112 2 -
GSHTLQGMNGCDMGPDG Q9TP68 112 2 -
GSHTWQCMYGCDVGPDG Q30838 119 2 -
GSHTFQWMFGCDLGPGG O46880 112 2 -
GSHTLQSMFGCYLGPDG O19241 112 2 -
GSHTLQSMFGCYLGPDG Q9TQ85 112 2 -
GSHTLQVMSGCDMGSDQ P79587 112 2 -
GSHTYQSMYGCYLGPDG O19075 112 2 -
GSHTLQDMYGCDVGPDG Q95479 115 2 -
GSHTIQWMSGCDVGSDG P79589 112 2 -
GSHTLQTLYRCEVGTEG Q9JHN6 111 2 -
GSHTLQGMNGCDMGPDG HLAF_MACMU 114 2 -
GSHTIQRMSGCDVGSDG P70466 115 2 -
GSHTLQWMHGCELGPDR HLAE_HUMAN 112 2 -
GSHTLQWMHGCELGPDR Q9GIY7 112 2 -
GSHTIQWMYGCDVGSDG Q31271 115 2 -
GSHTFQSMYGCGLGPDW Q9BCY6 112 2 -
GSHTIQIMYGCDVGPDG Q31068 115 2 -
GSHTIQIMYGCDVGPDG Q31069 115 2 -
GSHTIQVMYSCDVGSDG Q95558 114 2 -
GSHTVQRLSGCDVGSDG Q9JHM2 112 2 -
GSHTIQIMYGVGSDGRF Q29840 115 2 -
ASHTIQWMHGCDMGSDG Q95560 111 2 -
ESHTLQWMYGCDVGPDG HA15_MOUSE 111 2 -
GSHTLQWMHGCELGPDG Q30171 111 2 -
GSHTLQWMYGCDMGSDG HA17_MOUSE 112 2 -
ISHIIQSMVGCHVGSDG Q31246 114 2 -
GSHTIQWMYGCDVGSDG O77949 115 2 -
GSHNIQRMYGCDVDPDR Q95481 115 2 -
GSHNIQRMYGCDVDPDR Q95483 115 2 -
GSHNIQRMYGCDVDPDR Q95486 115 2 -
ESHTLQWMYGCDMGPDG O98032 111 2 -
GSHTLQLRFGCDVGPDG Q30484 115 2 -
GSHNIQRMYGCDVDPDR Q30493 115 2 -
ESHTLQWMYGCDVGPDG Q31153 111 2 -
ESHTLQWMYGCDVGPDG Q9QYQ4 111 2 -
ESHTLQWMYGCDVGPDG Q9TQB1 111 2 -
GSHNFQGMYGCDVDPDR Q95487 115 2 -
GSHTLQLMYGCDVGPHG Q30486 115 2 -
GSHTLQWMYGCDVGSDE HA18_MOUSE 112 2 -
GSHTLQWMYGCDVGSDE P79567 112 2 -
GSHTLQWMYGCDVGSDE P79568 112 2 -
GSHNIQRMYGCDVEPDG Q95482 115 2 -
GFHTFQRLSGCDMGLDG O19440 112 2 -
ESHTLQWMYGCDVGPDG O78105 111 2 -
GSHTFQLTYGCEEGSHG Q9TNZ1 110 2 -
GSHTIQRIYGCVMGSDG Q05081 112 2 -
GSHTIQRIFGCDLGSDG O77950 115 2 -
DPHTLQWMYGCDLGPDG Q95557 110 2 -
RSHTIQSLFGCDVGPDR Q9TSW5 112 2 -
RSHTIQSLFGCDVGPDR Q9TSW6 112 2 -
GIHTFQKLSGCDLGSDG O19441 112 2 -
GIHTFQKLSGCDLGSDG Q31215 112 2 -
GSHTFQQMYGCDLGSDG Q31216 115 2 -
GSHTVQLMYGCDILEDG O46792 110 1 -
GSHTFQWTSGCDVGPDG O46881 115 2 -
GSHTYQWLCGCYVARDG Q9TNZ2 112 2 -
GSHTVQLMYGCDILEDG Q9GIP6 110 1 -
GSHTVQWMFGCDILEDG O46790 110 1 -
GSHTVQWMYGCDILEDG O46788 110 1 -
GSHTIQVMYGCEVEFFG Q60678 117 2 -
GSHTVQWMYGCDILDDG Q95592 110 1 -
GSHTIQVMYGCEVEFFG Q95551 117 2 -
GSHTIQVMYGCEVEFFG HA1U_MOUSE 117 2 -
GSHTIQVMYGCEVEFFG Q31202 117 2 -
GSHTIQVMYGCEVEFFG HA1T_MOUSE 117 2 -
GSHTVQWMSGCDILEDG Q95601 110 1 -
GAHTLQLMYGCDLLEDG O62881 112 1 -
GSHTFQWISGCDLGPHG Q9GJE3 112 2 -
GLHTYQTMIGCEVHPDG Q9TPK7 115 2 -
GLHTYQTMIGCEVHPDG Q9TPL0 115 2 -
GSHTVQRMSGCDILEDG O46791 110 1 -
GSLTRQQMYGCDILEDG Q9TQD4 110 1 -
ESHSFLWVSGCDVGSDG Q9TNZ3 115 2 -
GSHTVQWMYGCDILEGG HA1F_CHICK 111 1 -
GSHTVQWMYGCDILEGG O73904 110 1 -
GSHTVQWMYGCDILEGG Q31400 110 1 -
GSHTVQWMYGCDILEGG O46789 110 1 -
SSHTIQRMTGCYIGPDG Q31204 122 2 -
GSHILQWMVSCEVGPDM Q31093 115 2 -
GSHTVQLMYGCDILEDG O73901 110 1 -
GSHIQQWMVSCEVGPDM Q31166 115 2 -
GSHTWQWMYGCDILDDS Q9TQD5 110 1 -
GSHILQWMVACEVGPDM Q62708 115 2 -
GSHILQWMVACEVGPDM Q9QYV4 115 2 -
GSHTFQTITGCDVGPDG Q30428 121 3 -
GVHSFQRMSGCEVSPEL Q30768 115 2 -
GLHTYQRMIGCELLEDG O19478 106 0 -
GLHTVQQMYGCELRGDG P79458 110 1 -
GSHTYQRMIGCELLEDG O97985 110 0 -
GSHTYQRMIGCELLEDG O97986 95 0 -
GSHTYQRMIGCELLEDG Q95460 110 0 -
GSHTYQRMIGCELLEDG Q9BCU2 110 0 -
GSHTYQRMIGCELLEDG Q9BCU3 110 0 -
GSHTYQRMIGCELLEDG Q9BCU4 110 0 -
GSHTYQRMIGCELLEDG Q9BD49 110 0 -
GSHTYQRMIGCELLEDG Q9BD50 110 0 -
GSHTYQRMIGCELLEDG Q9NPL2 110 0 -
GSHTYQRMIGCELLEDG Q9TQB9 106 0 -
GIHVLQRMYGCELREDG O46838 104 1 -
GIHVLQQMYGCELREDG O46829 104 1 -
GIHVLQRMYGCELREDG O46837 104 1 -
GIHVLQRMYGCELREDG O46846 104 1 -
GIHILQRMYGCELREDG O46847 104 1 -
GIHILQRMYGCELREDG O46828 104 1 -
GIHILQQMYGCELREDG O46817 104 1 -
GIHVLQQMYGCELREDG O46830 104 1 -
GVHTWQRMYGCELDDDG Q9GIW6 113 1 -
GIHVLQRMYGCELREDG O46836 104 1 -
GIHVLQQMYGCELREDG O46849 104 1 -
GIHVLQRMYGCELREDG O46845 104 1 -
GIHILQQMYGCELREDG O46818 104 1 -
GVHTVQLMYGCELGDDG Q31499 109 1 -
GIHVLQRMYGCELREDG O46843 104 1 -
GIHVLQRMYGCELREDG O46841 104 1 -
GIHIVQLMYGCDLRDDG Q9TP98 107 1 -
GVHTVQEMYGCELDDDG O62896 113 1 -
GIHVLQRMYGCELREDG O46835 104 1 -
GIHVLQRMYGCELREDG O46839 104 1 -
GIHVLQQMYGCELREDG O46844 104 1 -
GIHVLQQMYGCELREDG O46848 104 1 -
GTHMVQWMYGCELGDDG Q9TPA6 108 1 -
GVHTFQLMYGCELGDDG Q9GJB8 109 1 -
GVHTFQLMYGCELGDDG Q9TNX1 109 1 -
GIHVLQRMYGCELREDG O46840 104 1 -
GIHVLQRMYGCELREDG O46885 104 1 -
GTHMVQWMYGCELGDDG Q08546 108 1 -
GSHTMQMMFGCDILEDG Q9BCW3 109 1 -
GIHTYQLMCGCELRDDG Q9MX69 104 1 -
GIHILQQMYGCELREDG O46820 104 1 -
GIHTVQTMYGCELRDDG O19481 109 1 -
GIHVFQLMYGCELREDG O46831 104 1 -
GIHILQRMYGCELREDG O46825 104 1 -
GIHVLQRMSGCELREDG O46886 104 1 -
GTHSFQRMYGCELRDDG Q9TPA1 108 1 -
GIHVLQRMYGCELREDG O46842 104 1 -
GIHVFQLMYGCELREDG O46832 104 1 -
GIHILQLMYGCELREDG O46822 104 1 -
GTHSLQMMCGCELREDN Q9TPA0 108 1 -
GIHMYQRMYGCELREDG O46821 104 1 -
GIHMFQLMYGCELREDG O46827 104 1 -
GVHTWQNMYGCELDDDG O62894 113 1 -
GVHTWQNMYGCELDDDG O62895 113 1 -
GIHMFQLMYGCELREDG O46826 104 1 -
GIHMYQQMYGCELREDG O46824 104 1 -
GTHSFQRMYGCELRDDG Q9TPA2 108 1 -
GVHSFQFMYGCELDTDG O97982 104 1 -
GVHTFQNMYGCEWDDDT Q9TNN8 109 1 -
GVHINQRMYGCEWNDET Q9GIJ3 107 1 -
GVHINQRMYGCEWNDET Q9GJB9 107 1 -
GTHMVQYMYGCELGDDG Q9TPA5 71 1 -
GTHMVQWMYGCELGDDG Q9TPA4 108 1 -
GIHMYQLMYGCELREDG O46823 104 1 -
GIHILQLMCGCELREDG O46819 104 1 -
GIHVFQLMCGCELREDG O46834 104 1 -
GIHVFQLMYGCELREDG O46833 104 1 -
GTHMVQYMYGCELGDDG Q9TPA3 108 1 -
GVHSVQQMYGCELHDDG Q31387 104 1 -
GIHSFQLMYGCELRDDG Q9TP99 107 1 -
GLHTRLRVYGCELLSDG O98191 114 1 -
GLHTRLRVYGCELLSDG O98192 114 1 -
GVHTFQLMYGCELGDDG Q9MX28 101 1 -
GVHTFQFMVGCELEDDG Q9XRX0 104 1 -
GPHTLQFTYGCEMRDGR Q62585 121 14 -
GTHSLQVMYGCELREDN Q9TPA7 108 1 -
GVHIVQKMYGCEWDDEA Q9TNN4 109 1 -
GLHTVLRVYGCELLSDG O98187 114 1 -
GLHTWLRVIGCDLLSDG O98189 114 1 -
GYHTLQEVYGCNVANDG O19443 115 2 -
GIRTIQMMTGCDLRDDG O19480 104 1 -
GLHTVLRVIGCELLSDG O98188 114 1 -
GVHTWQMMCGCKRDDNA Q9GIW7 113 1 -
GPHTLQFTYGCEMRYNR Q31129 115 13 -
GLHTVLRVSGCELLSDG O98193 114 1 -
DFHTLQWQQGCDVGSDG Q31277 121 2 -
GVHVNQWMYGCEWDDEA Q31594 107 1 -
GVHIVQWMYGCEWDDEA P79570 109 1 -
DSHTLQWLQGCDVEPDR Q31208 116 2 -
DSHTLQWLQGCDVEPDR Q31615 116 2 -
DSHTLQWLQGCDVEPDR Q9BCZ1 116 2 -
GAHMFQWMYGCEWDDDD O98272 108 1 -
GVHVFQNMYGCEWDDEA Q9GJC2 107 1 -
DSHTLQWLQDCDVEPDR Q31206 116 2 -
GVHVYQWMYGCEWDDET Q9XR30 107 1 -
GVHTFQFMYGCEMDDDG Q31365 106 1 -
GVHIVQRMYGCEWDDEA Q9GJC0 101 1 -
GVHIVQRMYGCEWDDEA Q9TNW9 101 1 -
GVHIAQRMYGCEWDDET Q9GJE4 110 1 -
GVHIVQMMCGCEWDDET Q9GJC1 109 1 -
GSHTFQGMFGCEITNNR Q9DBB7 108 1 -
GSHTFQGMFGCEITNNR ZA2G_MOUSE 108 1 -
GSHVLQGRFGCEIENNR O60386 113 1 -
GSHVLQGRFGCEIENNR ZA2G_HUMAN 110 1 -
ESHTLQVILGCEVQEDN Q9GL43 114 1 -
GSHTFQGMFGCEITNNR ZA2G_RAT 108 1 -
GVHIAQRMYGCEWDDET O46706 110 1 -
ESHILQVVLGCEVHEDN HFE_MOUSE 126 9 -
ESHILQVVLGCEVHEDN Q9D754 126 9 -
GFHVFQRMYGCEWNDET Q9XR31 107 1 -
ESHTLQVILGCEVQEDN Q9GKZ0 114 1 -
ESHTLQVILGCEVQEDN Q9GL42 114 1 -
ESHTLQVILGCEVQEDN Q9GL41 114 1 -
ESHTLQVILGCEMQEDN HFE_HUMAN 114 1 -
ESHTLQVILGCEMQEDN O75929 114 1 -
GYHTLQWVHGCSLTDGI Q9TP04 113 1 -
GYHIIQETYGCQVKQRT O19442 115 2 -
GVHIYQNMYGCEWDDET O46705 110 1 -
ESHILQVILGCEVHEDN HFE_RAT 127 9 -

Motif 3 width=18
Element Seqn Id St Int Rpt
GYNQFAYDGKDYIALNED 1C12_HUMAN 136 4 -
GYNQFAYDGKDYIALNED 1C13_HUMAN 136 4 -
GYDQYAYDGKDYIALNED Q9TNR4 105 4 -
GYNQFAYDGKDYIALNED Q9TNN7 136 4 -
GYNQFAYDGKDYIALNED Q9TPX2 136 4 -
GYDQSAYDGKDYIALNED O78179 136 4 -
GYDQSAYDGKDYIALNED Q9MY34 136 4 -
GYDQSAYDGKDYIALNED 1C04_HUMAN 136 4 -
GYDQSAYDGKDYIALNED O78214 136 4 -
GYDQSAYDGKDYIALNED Q29862 136 4 -
GYDQSAYDGKDYIALNED O19617 136 4 -
GYDQSAYDGKDYIALNED Q95463 136 4 -
GYDQSAYDGKDYIALNED Q9GIK4 136 4 -
GHNQYAYDGKDYIALNED Q31603 136 4 -
GYHQDAYDGKDYIALNED Q29961 136 4 -
GHNQYAYDGKDYIALNED Q29767 136 4 -
GHDQSAYDGKDYIALNED 1B44_HUMAN 136 4 -
GYDQVAYDGKDYIALNED 1C15_HUMAN 136 4 -
GYRQYAYDGKDYIALNED Q9MXM0 136 4 -
GYDQYAYDGKDYIALNED 1B19_HUMAN 136 4 -
GHDQSAYDGKDYIALNED P79490 136 4 -
GYDQSAYDGKDYIALNED Q9UIP6 136 4 -
GHDQSAYDGKDYIALNED 1B11_HUMAN 136 4 -
GHDQSAYDGKDYIALNED Q95343 136 4 -
GHDQSAYDGKDYIALNED Q9MYC0 136 4 -
GHNQYAYDGKDYIALNED 1B39_HUMAN 136 4 -
GHNQYAYDGKDYIALNED P79489 136 4 -
GHNQYAYDGKDYIALNED P79555 136 4 -
GHNQYAYDGKDYIALNED Q29848 136 4 -
GYDQLAYDGKDYIALNED 1C01_GORGO 136 4 -
GYDQSAYDGKDYIALNED Q31627 136 4 -
GHDQSAYDGKDYIALNED Q9BD06 136 4 -
GHDQYAYDGKDYIALNED 1B02_HUMAN 136 4 -
GHNQYAYDGKDYIALNED 1B38_HUMAN 136 4 -
GHDQYAYDGKDYIALNED Q29638 136 4 -
GHDQYAYDGKDYIALNED Q08173 136 4 -
GYDQFAYDGKDYIALNED 1C11_HUMAN 136 4 -
GYDQFAYDGKDYIALNED Q9TQP9 136 4 -
GYDQFAYDGKDYIALNED Q29652 136 4 -
GYSQFAYDGKDYIALNED 1C02_GORGO 136 4 -
GYSQFAYDGKDYIALNED 1C04_GORGO 136 4 -
GHNQYAYDGKDYIALNED Q29854 136 4 -
GHNQYAYDGKDYIALNED Q31610 136 4 -
GHNQYAYDGKDYIALNED Q31613 136 4 -
GHNQYAYDGKDYIALNED 1B34_HUMAN 136 4 -
GHNQYAYDGKDYIALNED 1B46_HUMAN 136 4 -
GYYQDAYDGKDYIALNED Q9MXC8 136 4 -
GHNQYAYDGKDYIALNED Q30173 136 4 -
GYDQSAYDGKDYIALNED 1C16_HUMAN 136 4 -
GYDQSAYDGKDYIALNED O78211 136 4 -
GYDQSAYDGKDYIALNED Q29963 136 4 -
GYNQLAYDGKDYIALNED 1B48_HUMAN 136 4 -
GYNQLAYDGKDYIALNED Q9GIZ0 136 4 -
GHDQSAYDGKDYIALNED Q29982 136 4 -
GHDQYAYDGKDYIALNED Q29681 136 4 -
GHDQYAYDGKDYIALNED Q29861 136 4 -
GHNQYAYDGKDYIALNED 1B04_HUMAN 136 4 -
GYDQYAYDGKDYIALNED 1C02_HUMAN 136 4 -
GYDQYAYDGKDYIALNED Q9MXH3 136 4 -
GHDQSAYDGKDYIALNED Q29943 136 4 -
GYHQDAYDGKDYIALNED Q29693 136 4 -
GHDQSAYDGKDYIALNED 1B36_HUMAN 136 4 -
GHDQSAYDGKDYIALNED P79549 136 4 -
GHDQSAYDGKDYIALNED Q29981 136 4 -
GHDQSAYDGKDYIALNED O19790 136 4 -
GYRQFAYDGKDYIALNED Q9MXH4 136 4 -
GYDQYAYDGKDYIALNED Q9MXC9 136 4 -
GYDQSAYDGKDYIALNED 1C03_HUMAN 136 4 -
GYDQSAYDGKDYIALNED 1C17_HUMAN 136 4 -
GYDQSAYDGKDYIALNED O78178 136 4 -
GYDQSAYDGKDYIALNED Q29641 136 4 -
GYDQSAYDGKDYIALNED Q30192 136 4 -
GYNQFAYDGKDYIALNED 1C14_HUMAN 136 4 -
GHNQLAYDGKDYIALNED 1B59_HUMAN 136 4 -
GYDQYAYDGKDYIALNED Q9MXI1 136 4 -
GYDQYAYDGKDYIALNED Q9MXK3 136 4 -
GHNQFAYDGKDYIALNED 1B32_HUMAN 136 4 -
GYHQDAYDGKDYIALNED Q29705 136 4 -
GYHQDAYDGKDYIALNED 1B14_HUMAN 136 4 -
GYHQDAYDGKDYIALNED 1B18_HUMAN 136 4 -
GYHQDAYDGKDYIALNED O78189 136 4 -
GYDQSAYDGKDYIALNED Q29748 136 4 -
GYDQYAYDGKDYIALNED Q9MXL6 136 4 -
GYDQSAYDGKDYIALNED Q9UQS9 136 4 -
GYNQFAYDGKDYIALNED O02865 136 4 -
GHNQFAYDGKDYIALNED Q29836 136 4 -
GHNQYAYDGKDYIALNED Q29855 136 4 -
GHNQYAYDGKDYIALNED Q9TPW6 136 4 -
GYEQYAYDGKDYIALNQD Q9MXK4 136 4 -
GYQQDAYDGKDYIALNED 1A34_HUMAN 136 4 -
GYGQYAYDGKDYIALNED Q9MXD0 136 4 -
GYEQYAYDGKDYIALNED 1B02_PANTR 136 4 -
GYEQYAYDGKDYIALNED Q9MXK0 136 4 -
GYHQHAYDGKDYIALNED Q29846 136 4 -
GHNQYAYDGKDYIALNED P79612 136 4 -
GYDQSAYDGKDYIALNED Q29864 136 4 -
GYNQFAYDGKDYIALNED 1B07_HUMAN 136 4 -
GYNQFAYDGKDYIALNED 1B08_HUMAN 136 4 -
GYDQSAYDGKDYIALNEH Q29959 136 4 -
GYDQSAYDGKDYIALNEH Q29960 136 4 -
GYRQFAYDGKDYIALNED Q9MXH2 136 4 -
GHNQYAYDGKDYIALNED Q29842 136 4 -
GYEQFAYDGKDYIALNED O46684 136 4 -
GYEQFAYDGKDYIALNED Q9MXD2 136 4 -
GYEQFAYDGKDYIALNED Q9TPL2 136 4 -
GYDQSAYDGKDYIALNED O78083 136 4 -
GYDQSAYDGKDYIALNED Q95603 136 4 -
GHNQFAYDGKDYIALNED Q29749 136 4 -
GYYQDAYDGKDYIALNED Q9MXH5 136 4 -
GYDQFAYDGKDYIALNED Q9XRY3 136 4 -
GYDQYAYDGKDYIALNED Q9MXC6 136 4 -
GYDQYAYDGKDYIALNED Q9MXG6 136 4 -
GYRQFAYDGKDYIALNKD Q9MXI2 136 4 -
GYRQFAYDGKDYIALNKD Q9TPL5 136 4 -
GYRQYAYDGKDYIALNED Q9MXL9 136 4 -
GYEQLAYDGKDYIALNED Q9MXL7 136 4 -
GYDQSAYDGKDYIALNED 1B10_HUMAN 136 4 -
GHNQYAYDGKDYIALNED 1B20_HUMAN 112 4 -
GHNQFAYDGKDYIALNED 1B31_HUMAN 136 4 -
GHNQFAYDGKDYIALNED Q29847 136 4 -
GYNQFAYDGKDYIALNED 1C07_HUMAN 136 4 -
GYNQFAYDGKDYIALNED Q29921 136 4 -
GYNQFAYDGKDYIALNED Q29865 136 4 -
GYNQFAYDGKDYIALNED P79498 136 4 -
GYNQFAYDGKDYIALNED 1B29_HUMAN 136 4 -
GYYQHAYDGKDYIALNED Q9MXM1 136 4 -
GYHQDAYDGKDYIALNED 1B45_HUMAN 136 4 -
GYHQDAYDGKDYIALNED Q9GIL3 136 4 -
GHDQSAYDGKDYIALNED 1B12_HUMAN 136 4 -
GYDQSAYDGKDYIALNED Q29844 136 4 -
GHDQSAYDGKDYIALNED Q30172 136 4 -
GHDQYAYDGKDYIALNED Q9TP95 136 4 -
GYRQFAYDGKDYIALNED Q9MXH1 136 4 -
GHNQFAYDGKDYIALNED Q29852 136 4 -
GYDQSAYDGKDYIALNED 1CXX_HUMAN 112 4 -
GYRQFAYDGKDYIALNED Q9MXH0 136 4 -
GYQQDAYDGKDYIALNED 1A66_HUMAN 136 4 -
GHDQSAYDGKDYIALNED Q9BCM6 136 4 -
GYQQDAYDGKDYIALNED P79563 136 4 -
GYHQDAYDGKDYIALNED 1B15_HUMAN 136 4 -
GHDQSAYDGKDYIALNED 1B25_HUMAN 136 4 -
GYDQYAYDGKDYIALNED 1C01_HUMAN 136 4 -
GYDQYAYDGKDYIALNED Q29992 136 4 -
GHDQSAYDGKDYIALNED 1B13_HUMAN 136 4 -
GYSQFAYDGKDYIALNED 1C03_GORGO 136 4 -
GHNQLAYDGKDYIALNED 1B55_HUMAN 136 4 -
GHNQLAYDGKDYIALNED 1B56_HUMAN 136 4 -
GHNQLAYDGKDYIALNED 1B57_HUMAN 136 4 -
GHNQLAYDGKDYIALNED P79523 136 4 -
GYDQSAYDGKDYIALNED 1C06_HUMAN 136 4 -
GHDQYAYDGKDYIALNED O19554 136 4 -
GYNQLAYDGKDYIALNED 1B43_HUMAN 136 4 -
GYNQLAYDGKDYIALNED O78172 136 4 -
GHNQYAYDGKDYIALNED Q29637 136 4 -
GYHQDAYDGKDYIALNED Q31602 136 4 -
GYHQDAYDGKDYIALNED Q9GIX2 136 4 -
GYDQYAYDGKDYIALNED Q9GIK8 136 4 -
GYQQDAYDGKDYIALNED 1A26_HUMAN 136 4 -
GYQQDAYDGKDYIALNED Q95377 136 4 -
GYQQDAYDGKDYIALNED Q9MY52 136 4 -
GHNQYAYDGKDYIALNED 1B35_HUMAN 136 4 -
GHDQFAYDGKDYIALNED Q31605 136 4 -
GYRQDAYDGKDYIALNED Q29747 136 4 -
GHNQLAYDGKDYIALNED 1B58_HUMAN 136 4 -
GYDQDAYDGKDYIALNED Q9BCM7 136 4 -
GYDQYAYDGKDYLALNED Q9TPL4 136 4 -
GYNQFAYDGKDYIALNED Q95604 136 4 -
GYHQDAYDGKDYIALNED 1B16_HUMAN 136 4 -
GHNQYAYDGKDYIALNED O78218 136 4 -
GYNQLAYDGKDYIALNED 1B47_HUMAN 136 4 -
GHDQLAYDGKDYIALNED 1C18_HUMAN 136 4 -
GHDQLAYDGKDYIALNED O78165 136 4 -
GHDQSAYDGKDYIALNED Q29644 136 4 -
GYQQDAYDGKDYIALNED 1A74_HUMAN 136 4 -
GYDQYAYDGRDYIALNED Q9TNR1 112 4 -
GYDQHAYDGKDYIALNED 1C05_HUMAN 136 4 -
GHDQSAYDGKDYIALNED Q29932 136 4 -
GHDQSAYDGKDYIALNED Q29845 136 4 -
GYQQDAYDGKDYIALNED Q9MW42 136 4 -
GYRQYAYDGKDYIALNED Q9MXK9 136 4 -
GYEQYAYDGKDYIALNQD 1A02_PANTR 136 4 -
GYEQYAYDGKDYIALNQD Q9MXI3 136 4 -
GYSQSAYDGKDYIALNED 1B01_GORGO 136 4 -
GHNQYAYDGKDYIALNED 1B22_HUMAN 136 4 -
GHNQYAYDGKDYIALNED O19755 136 4 -
GHNQYAYDGKDYIALNED Q29669 136 4 -
GYRQDAYDGKDYIALNED 1A11_HUMAN 136 4 -
GYRQDAYDGKDYIALNED Q9BCN0 136 4 -
GYRQDAYDGKDYIALNED Q9MYI5 136 4 -
GYRQDAYDGKDYIALNED Q9TQP6 136 4 -
GYRQDAYDGKDYIALNED Q9TQP7 136 4 -
GHNQFAYDGKDYIALNED Q29858 136 4 -
GHDQFAYDGKDYIALNED 1B23_HUMAN 136 4 -
GYDQYAYDGKDYLALNED Q9MXC7 136 4 -
GYDQYAYDGKDYLALNED Q9MXG5 136 4 -
GHNQFAYDGKDYIALNED Q29697 136 4 -
GYSQSAYDGKDYIALNED 1B03_GORGO 136 4 -
GYRQYAYDGKDYIALNQD Q9MXD1 136 4 -
GHDQSAYDGKDYIALNED Q29700 136 4 -
GYDQYAYDGKDYIALNKD Q9MXK1 136 4 -
GHNQFAYDGKDYIALNED Q29935 136 4 -
GYQQDAYDGKDYIALNED 1A03_GORGO 136 4 -
GHDQSAYDGKDYIALNED 1B21_HUMAN 136 4 -
GHDQSAYDGKDYIALNED 1B27_HUMAN 136 4 -
GHDQSAYDGKDYIALNED 1B28_HUMAN 136 4 -
GHDQSAYDGKDYIALNED Q9MY33 136 4 -
GHNQFAYDGKDYIALNED 1B26_HUMAN 136 4 -
GYSQSAYDGKDYIALNED 1B02_GORGO 136 4 -
GYYQYAYDGKDYLALNED Q9MXH7 136 4 -
GHDQSAYDGKDYIALNED Q29633 136 4 -
GHDQSAYDGKDYIALNED Q29985 136 4 -
GYSQLAYDGKDYLALNED 1B04_GORGO 136 4 -
GYDQSAYDGKDYIALNED Q29911 136 4 -
GHDQLAYDGKDYIALNED Q29991 136 4 -
GYRQYAYDGKDYIALNQD Q9MXI0 136 4 -
GYEQHAYDGKDYIALNED 1A30_HUMAN 136 4 -
GHNQYAYDGKDYIALNED 1B63_HUMAN 136 4 -
GYQQDAYDGKDYIALNED 1A25_HUMAN 136 4 -
GYRQDAYDGKDYIALNED 1A01_PANTR 136 4 -
GYYQSAYDGKDYIALNED Q9MXH6 136 4 -
GHDQSAYDGKDYIALNED O78180 136 4 -
GYQQDAYDGKDYIALNED 1A43_HUMAN 136 4 -
GYRQDAYDGKDYIALNED Q9TPL7 136 4 -
GYQQDAYDGKDYIALNED 1A02_GORGO 136 4 -
GYRQDAYDGKDYIALNED Q9MXM7 136 4 -
GHNQFAYDGKDYIALNED Q95365 136 4 -
GHNQYAYDGKDYIALNED Q29924 136 4 -
GYRQDAYDGKDYIALNED 1A03_PANTR 136 4 -
GYRQYAYDGKDYIALNQD Q9MXK5 136 4 -
GHNQLAYDGKDYIALNED 1B05_HUMAN 136 4 -
GHNQLAYDGKDYIALNED Q9MYB8 136 4 -
GYDQDAYDGKDYIALNED 1B41_HUMAN 136 4 -
GYDQDAYDGKDYIALNED 1B42_HUMAN 136 4 -
GYDQDAYDGKDYIALNED P79524 136 4 -
GYDQDAYDGKDYIALNED Q29850 136 4 -
GHNQLAYDGKDYIALNED Q29661 136 4 -
GHNQYAYDGKDYIALNED Q29857 136 4 -
GYRQDAYDGRDYIALNED O19446 136 4 -
GYRQDAYDGRDYIALNED Q31266 126 4 -
GYYQYAYDGKDYIALNED Q9MXM2 136 4 -
GYNQFAYDGKDYIALNED Q31612 136 4 -
GYCQFAYDGKDYIALNED Q9XRX9 136 4 -
GYHQFAYDGKDYIALNED Q30719 136 4 -
GYQQDAYDGKDYIALNED 1A01_GORGO 136 4 -
GYEQYAYDGRDYIALNED Q30720 133 4 -
GYGQYAYDGKDYIALNED Q9MXJ9 136 4 -
GYQQDAYDGKDYIALNED 1A32_HUMAN 136 4 -
GYQQDAYDGKDYIALNED Q9GJ44 136 4 -
GYQQDAYDGKDYIALNED Q9GJ45 136 4 -
GYDQYAYDGKDYIALNED Q29993 136 4 -
GYSQSAYDGKDYIALNED Q9MXG3 136 4 -
GYDQDAYDGKDYIALNED Q9MYC3 136 4 -
GYRQDAYDGKDYIALNED 1A36_HUMAN 136 4 -
GYDQYAYDGRDYIALNED Q9TNR2 112 4 -
GYQQDAYDGKDYIALNED 1A31_HUMAN 136 4 -
GYDQDAYDGKDYIALNED Q9UQS8 136 4 -
GHDQSAYDGKDYIALNED Q29941 136 4 -
GYDQFAYDGKDYIALNQD Q30712 136 4 -
GYRQFAYDGKDYIALNED Q9MXM4 136 4 -
GYRQDAYDGKDYIALKED 1A68_HUMAN 136 4 -
GYEQHAYDGKDYIALNED 1A01_PONPY 136 4 -
GHNQLAYDGKDYIALNED Q29940 136 4 -
GYRQDAYDGKDYIALNED 1A04_PANTR 136 4 -
GYQQDAYDGKDYIALNED Q9MYG5 136 4 -
GYGQFAYDGKDYIALNQD Q9TPL6 136 4 -
GYYQYAYDGKDYLALNED Q9MXH8 136 4 -
GYHQYAYDGKDYFALNED Q30711 133 4 -
GYHQYAYDGKDYFALNED Q30716 136 4 -
GYYQYAYDGKDYLALNED Q9MXH9 136 4 -
GYRQVAYDGKDYIALKED Q9UIN2 136 4 -
GYDQDAYDGKDYIALNED Q29849 136 4 -
GYDQHAYDGKDYIALNED 1A01_SAGOE 136 4 -
GHNQYAYDGKDYIALNED 1B53_HUMAN 136 4 -
GYRQDAYDGRDYIALNED Q30287 111 4 -
GYEQHAYDGKDYIALNED Q9MXL0 136 4 -
GYRQDAYDGKDYIALNED 1A03_HUMAN 141 4 -
GYRQDAYDGKDYIALNED Q9MYG4 136 4 -
GYRQDAYDGKDYIALNED O19756 136 4 -
GYEQYGYDGRDYIALNED Q95394 136 4 -
GHDQSAYDGKDYIALNED Q29925 136 4 -
GHDQSAYDGKDYIALNED 1B54_HUMAN 136 4 -
GYEQHAYDGKDYIALNED Q9MXI8 136 4 -
GYEQHAYDGKDYIALNED Q9TPL3 136 4 -
GYYQYAYDGKDYIALNED Q30988 136 4 -
GYHQYAYDGKDYIALNED Q9TQB6 136 4 -
GHNQYAYDGKDYIALNED Q29938 136 4 -
GHNQLAYDGKDYIALNED Q29718 136 4 -
GYQQDAYDGKDYIALNED 1A33_HUMAN 136 4 -
GHNQYAYDGKDYIALNED 1B49_HUMAN 136 4 -
GHNQYAYDGKDYIALNED O78173 136 4 -
GYEQFAYDGKDYIALNED Q9MXM3 136 4 -
GHNQLAYDGKDYIALNED Q9GIY5 136 4 -
GYLQDAYDGADYIALNED Q9BD51 136 4 -
GYEQFAYDGRDYIALNED Q30718 136 4 -
GYSQYAYDGKDYLALNED Q9MWK4 136 4 -
GYDQYAYDGRDYIALNED Q9GJ78 136 4 -
GHNQYAYDGKDYIALNED 1B52_HUMAN 136 4 -
GYSQDAYDGADYIALNED Q30482 133 4 -
GYRQDAYDGKDYIALNED 1A29_HUMAN 136 4 -
GYEQLAYDGKDYIALNED Q9MXK7 136 4 -
GYYQRAYDGKDYIALNED Q30595 133 4 -
GYLQDAYDGKDYITLNED 1OKO_GORGO 136 4 -
GHDQSAYDGKDYIALNED 1B62_HUMAN 136 4 -
GYRQDAYDGKDYIALNED Q30900 136 4 -
GHNQYAYDGKDYIALNED 1B61_HUMAN 136 4 -
GHNQYAYDGKDYIALNED P79496 136 4 -
GYDQHAYDGKDYIALNED Q29988 136 4 -
GYGQYAYDSKDYIALNKD Q9MXL8 136 4 -
GYRQDAYDGKDYIALNED Q9MXM6 136 4 -
GYQQDAYDGKDYIASNED 1A04_GORGO 136 4 -
GHDQSAYDGKDYIALNED 1B60_HUMAN 136 4 -
GHDQSAYDGKDYIALNED Q9MYI6 136 4 -
GYYQSAYDGKDYFALNED Q30868 136 4 -
GYQQHAYDGCDYIALNED Q31142 133 4 -
GYYQSAYDGKDYFALNED Q9BCY9 136 4 -
GYGQSAYDGKDYIALNED 1C01_PANTR 136 4 -
GYRQDAYDGKDYIALNED Q9MXM5 136 4 -
GYEQHAYDGKDYIALNED HLAH_HUMAN 136 4 -
GYRQDAYDGKDYIALNED Q9MXI6 136 4 -
GYHQYAYDGKDYIALKED 1A02_HUMAN 136 4 -
GYHQYAYDGKDYIALKED O78126 133 4 -
GYHQYAYDGKDYIALKED P79603 136 4 -
GYHQYAYDGKDYIALKED Q9MYB7 136 4 -
GYHQYAYDGKDYIALKED Q9TQ73 136 4 -
GYDQHAYDGKDYIALNED Q9XRY2 136 4 -
GYEQLAYDGKDYIALNED Q9MXL4 136 4 -
GYHQRAYDGKDYIALNED Q30871 136 4 -
GYHQRAYDGKDYIALNED Q9BCY7 136 4 -
GYRQDAYDGADYIALNED Q30485 133 4 -
GYHQYAYDGKDYIALNED 1C01_SAGOE 136 4 -
GYRQDAYDGKDYIALNED 1A80_HUMAN 136 4 -
GYRQDAYDGKDYIALNED Q9MXJ2 136 4 -
GYQQHAYDGRDYIALNED Q31172 133 4 -
GYEQYAYDGRDYIALNED Q9MXS5 136 4 -
GYYQSAYDGRDYIALNED Q9MXQ3 136 4 -
GYEQYAYDGKDYIALNED Q30901 136 4 -
GFMQDAYDGRDYIALNED O77975 133 4 -
GYEQYAYDGRDYIALNED Q30591 108 4 -
GYRQDAYDGRDYIALNED HA12_RAT 136 4 -
GYEQFAYDGRDYIALNED Q31196 131 4 -
GYRQDAYDGKDYIALNED 1A01_HUMAN 136 4 -
GYDQYAYDGKDYIALNED Q9TNR3 112 4 -
GYDQHAYDGKDYISLNED 1B01_SAGOE 136 4 -
GYEQFAYDGCDYIALNED HA1L_MOUSE 136 4 -
GYEQYAYDGADYLALNED Q9BD53 136 4 -
GYEQHAYDGRDYIALNED Q31254 133 4 -
GYHQYAYDGKDYIALKED Q9TQ65 136 4 -
GYHQYAYDGKDYIALKED Q29757 136 4 -
GYYQSAYDGRDYIALNED Q9MXR5 136 4 -
GYYQSAYDGRDYIALNED Q9MXS3 136 4 -
GYEQYGYDGRDYLALNED Q30291 133 4 -
GYEQFAYDGKDYIALNED Q30715 136 4 -
GYRQSAYDGADYIALNED Q9GIW5 136 4 -
GYHQYAYDGKDYIALKED Q9TQ74 136 4 -
GYEQYAYDGRDYIALNED Q30870 136 4 -
GYEQYAYDGRDYIALNED Q9BCZ0 136 4 -
GYYQFAYDGKDYIALNED Q30714 68 4 -
GFMQYGYDGRDYLALNED HA1A_BOVIN 133 4 -
GYSQYAYDGRDYIALNGD Q9TNR0 112 4 -
GYEQYAYDGCDYIALNED Q31149 136 4 -
GYHQDAYDGADYIALNED O19242 133 4 -
GYSQDAYDGRDYIALNED Q95393 133 4 -
GYEQFAYDGKDYIALNDD Q30592 108 4 -
GYEQYAYDGRDYIALNED Q31255 133 4 -
GYEQFAYDGCDYIALNED HA13_MOUSE 136 4 -
GYEQFAYDGKDYLTLNED Q9BCY4 130 4 -
GYHQYAYDGKDYIALKED Q29907 136 4 -
GYEQYAYDGCDYIALNED HA1K_MOUSE 133 4 -
GYEQYAYDGCDYIALNED Q95458 133 4 -
GYEQSAYDGRDYLALNED Q31188 136 4 -
GYEQHAYDGKDYIALNED Q9MXK6 136 4 -
GYEQVAYDGCDYIALNED HA1W_MOUSE 133 4 -
GYEQYAYDGCDYIALNED Q31173 133 4 -
GYWQYAYDGADYLALNED Q9BD52 136 4 -
GYSQFAYDGADYIALNED Q30483 133 4 -
GYQQYAYDGCDYIALNED HA1B_MOUSE 133 4 -
GYEQVAYDGRDYIALNED Q61895 133 4 -
GYEQYAYDGKDYLALNED HLAG_HUMAN 136 4 -
GYEQYAYDGKDYLALNED Q9TP69 133 4 -
GYEQYAYDGKDYLALNED Q30182 136 4 -
GYLQYAYDGRDYIALNED Q31214 136 4 -
GYRQLAYDGRDYIALNED Q61896 133 4 -
GYYQSAYDGRDYISLNED Q30721 136 4 -
GYSQDAYDGADYIALNED HA19_CANFA 136 4 -
GFDQSAYDGLDYIALNED Q31155 136 4 -
GYEQVAYDGRDYIALNED Q61894 133 4 -
GYTQFGYDGRDYLALNED O77976 133 4 -
GYSQFAYDGAEYITLNED Q30488 132 4 -
GYQQHAYDGRDYIALNED Q31170 136 4 -
GYEQFAYDGCDYIALNED Q61642 133 4 -
GYEQFAYDGCDYIALNED Q64272 133 4 -
GYWQFAYDGCDYIALNED HA12_MOUSE 136 4 -
GYEQYAYDGCDYIALNED Q61892 136 4 -
GYTQYAYDGKDYIALNDD Q9JHN5 132 4 -
GYEQFAYDGPDYIALNED HA14_MOUSE 133 4 -
GYHQYAYDGKDYIALKED Q29689 136 4 -
GYEQFAYDGADYIALNED Q30849 133 4 -
GYDQFAYDGRDYIALNED Q30290 135 3 -
GYTQYAYDGKDYIALNDD Q9JHN7 132 4 -
GYEQHAYDGRDYIALNED HA11_RAT 136 4 -
GYEQYAYDGCDYIALNED Q95457 136 4 -
GYHQYAYDGKDYIALKED 1A23_HUMAN 136 4 -
GYHQYAYDGKDYIALKED Q9MY72 136 4 -
GYHQYAYDGKDYIALKED Q9BCN1 136 4 -
GYHQYAYDGKDYIALKED O15506 136 4 -
GYHQYAYDGKDYIALKED 1A24_HUMAN 136 4 -
GYEQYAYDGLDYIALNED Q61893 133 4 -
GFWQFGYDGRDYIALNEE HA1B_BOVIN 139 4 -
GFMQFGYDGRDYIALNQD O78186 133 4 -
GYSQDAYDGADYIALNED O46882 136 4 -
GYEQFAYDGRDYIILNED O02948 136 4 -
GYRQSAYDGRDYLALNED Q61891 136 4 -
GYSQFAYDGKDYIALKDD Q9JHN4 132 4 -
GYRQYAYDGRDYIALNED Q30289 136 4 -
GYQQYAYDGCDYIALNED Q31169 136 4 -
GYSQFGYDGADYLALNED O19240 136 4 -
GYLQYAYDGRDYIALNED HA10_MOUSE 133 4 -
GYYQSAYDGRDYIALNED Q30869 136 4 -
GFMQFAYDGRDYIALNED Q95395 136 4 -
GFMQFAYDGRDYIALNED Q95477 136 4 -
GYRQFAYDGADYLALNED O19243 136 4 -
GYRQDAYDGADYIALNED O19244 133 4 -
GYRQDAYDGADYIALNED Q31066 133 4 -
GYRQDAYDGADYIALNED Q31067 133 4 -
GYHQFAYDGKDYIALNGD Q9BCY8 136 4 -
GYEQFAYDGKDYLTLNED Q30593 130 4 -
GYDQFAYDGRDYLALNED O19445 133 4 -
GYDQFAYDGRDYLALNED Q08680 133 4 -
GFTQFGYDGRDYIALNED O77977 133 4 -
GYQQFAYDGRDYIALNED HA1D_MOUSE 133 4 -
GYQQFAYDGRDYIALNED O35641 133 4 -
GYQQFAYDGRDYIALNED Q31191 121 4 -
GYQQFAYDGRDYIALNED Q31634 133 4 -
GYEQFAYDGRDYIALNED Q31148 133 4 -
GYEQFAYDGRDYIALNED Q31267 133 4 -
GYLQYAYDGRDYIALNED Q31141 133 4 -
GYERYAYDGKDYLALNED Q9MYA2 136 4 -
GYRQSAYDGCDYIALNED Q31218 133 4 -
GYDQYAYDGRDYIALNED Q30713 133 4 -
GYRQDAYDGRDYIALNED Q31256 133 4 -
GYRQDAYDGRDYIALNED Q95577 133 4 -
ASFQYAYDGADYIALNED Q95480 132 4 -
GYLQDAYDGKDYIALNDD Q9JHN3 132 4 -
GYHQFAYDGRDYLALNDD Q95559 133 4 -
GYEQYAYDGRDYIALNED P79588 133 4 -
GYSQDAYDGADYIALNED Q9TSW1 136 4 -
GYSQDAYDGADYIALNED Q9TSW2 136 4 -
GYDQYGYDGRDYLALNED O77973 136 4 -
GYEQFAYDGRDYIALNED Q31614 133 4 -
GYHQHAYDGKDYISLNED 1C28_PANTR 133 4 -
GYSQDAYDGADYIALNED O19245 136 4 -
GYFNSAYDGADYIALNED Q30481 136 4 -
GYSQFGYDGADYIALNED Q9TSW3 133 4 -
GYSQFGYDGADYIALNED Q9TSW4 133 4 -
GYLQFAYEGRDYIALNED HA11_MOUSE 136 4 -
GYRQYAYDGADYIALNED HA1A_RABIT 136 4 -
GYRQYAYDGADYIALNED HA1B_RABIT 136 4 -
GYEQFAYDGKDYLTLNED Q9GIY8 133 4 -
GYNQYAYDGKDYIALNED Q9MXS4 136 4 -
GFMQDAYDSRDYIALNED O77974 136 4 -
GYSQVAYDGKDYISLNED O98028 136 4 -
GYHQFAYDGKDYIALNGD Q9BCY5 133 4 -
GFWQFGYDGRNYIALNED O77972 133 4 -
GYHQHAYDGKDYISLNED HLAF_HUMAN 133 4 -
GYHQHAYDGKDYISLNED Q9TP68 133 4 -
GFMQFGYDGRDYIALNED Q30838 140 4 -
GYSQDAYDGADYIALNED O46880 133 4 -
GYRQDAYDGADYIALNED O19241 133 4 -
GYRQDAYDGADYIALNED Q9TQ85 133 4 -
GYEQYAYDGRDYISLNKD P79587 133 4 -
GYRQYAYDGADYIALNED O19075 133 4 -
RVQTVAYDGADYIALNED Q95479 136 4 -
GYDQFAYDGRDYIVLNED P79589 133 4 -
GYSQFAYDGKDYIALNDD Q9JHN6 132 4 -
GYHQHAYDGKDYISLNED HLAF_MACMU 135 4 -
GYYQYAYDGRDYLALNDD P70466 136 4 -
GYEQFAYDGKDYLTLNED HLAE_HUMAN 133 4 -
GYEQFAYDGKDYLTLNED Q9GIY7 133 4 -
GYWQHAYDGRDYLALNED Q31271 136 4 -
GYYQSAYDGRDYIALNKD Q9BCY6 133 4 -
GYSQETYDGADYIALNED Q31068 136 4 -
GYSQETYDGADYIALNED Q31069 136 4 -
GYSQDAYDGRDYIALNDD Q95558 135 4 -
GYNQHAYDGRDYIALNED Q9JHM2 133 4 -
GYRQDAYDGKDYIALNED Q29840 134 2 -
GYEQHAYDGRDYIALNDD Q95560 132 4 -
GYCQEAYDGQDYISLNED HA15_MOUSE 132 4 -
GYEQFAYDGKDYLTLNED Q30171 131 3 -
GYLQFAYEGRDYIALNED HA17_MOUSE 133 4 -
GYSQDAYDGDDYIALNED Q31246 135 4 -
GYWQHAYDGRDYLALNED O77949 136 4 -
GYRQESYDGKDYIALNED Q95481 136 4 -
GYRQESYDGKDYIALNED Q95483 136 4 -
GYSQDSYDGKDYIALNED Q95486 136 4 -
GYCQEAYDGQDYISLNED O98032 132 4 -
GYRQSAYDGADYIALNED Q30484 136 4 -
GYSQDSYDGKDYIALNED Q30493 136 4 -
GYCQEAYDGQDYISLNED Q31153 132 4 -
GYCQEAYDGQDYISLNED Q9QYQ4 132 4 -
GYCQEAYDGQDYISLNED Q9TQB1 132 4 -
GYSQLAYDGKDYIALNED Q95487 136 4 -
ASFQYAYDGADYLALNED Q30486 136 4 -
GYLQFAYEGRDYIALNED HA18_MOUSE 133 4 -
GYLQFAYEGRDYIALNED P79567 133 4 -
GYLQFAYEGRDYIALNED P79568 133 4 -
GYSQDSYDGKDYIALNED Q95482 136 4 -
GYLQFAYDGRDYITLNED O19440 133 4 -
GYCQEAYDGRDYISLNED O78105 132 4 -
AHWQYAYDGEDYITLNED Q9TNZ1 131 4 -
GYWQFAYDGRDYMALNED Q05081 133 4 -
GYDQLAYDGLDHIALKED O77950 136 4 -
GYCQEAYDGRDYIALNDD Q95557 131 4 -
RYRQDAYDGADYLALNED Q9TSW5 133 4 -
RYRQDAYDGADYLALNED Q9TSW6 133 4 -
GYLQFAYDGLDYIALNED O19441 133 4 -
GYLQFAYDGLDYIALNED Q31215 133 4 -
GYWQLAYDGRDYIALNED Q31216 136 4 -
GYSQYAYDGRDFIALDKD O46792 130 3 -
GYEQFAYDGADYLALDED O46881 136 4 -
GYSQFAYDGADYIVLNED Q9TNZ2 133 4 -
GYSQDAYDGRDFIAFDKD Q9GIP6 130 3 -
GYRQSAYDGRDFIALDKD O46790 130 3 -
GYYQTAYDGRDFIAFDKG O46788 130 3 -
AYEQHGYDGRDYIALNED Q60678 138 4 -
GYNQYAYDGRDFIVFDKD Q95592 130 3 -
AYEQHGYDGQDYIALNED Q95551 138 4 -
AYEQHGYDGQDYIALNED HA1U_MOUSE 138 4 -
AYEQHGYDGQDYIALNED Q31202 138 4 -
AYEQHGYDGPDYIALNED HA1T_MOUSE 138 4 -
GYHQAAYDGRDFVAFDKG Q95601 130 3 -
GYWQYAYDGRDFIAFDTD O62881 132 3 -
GYEEFAYDGADYISLNED Q9GJE3 133 4 -
GFWQHAYDGHDYIALDRE Q9TPK7 136 4 -
GFWQHAYDGHDYIALDRE Q9TPL0 136 4 -
GYYQEADDGRDFIAFDKG O46791 130 3 -
GYDQVAYNGRDFIAFDKD Q9TQD4 130 3 -
GYEQFSYDGDDYIVLNED Q9TNZ3 136 4 -
GYYQMAYDGRDFTAFDKG HA1F_CHICK 131 3 -
GYYQMAYDGRDFTAFDKG O73904 130 3 -
GYYQMAYDGRDFTAFDKG Q31400 130 3 -
GYYQMAYDGRDFTAFDKG O46789 130 3 -
AYRQFGYDGQDYLTLNED Q31204 143 4 -
AHYQAAYDGSDYITLNED Q31093 136 4 -
GYHQTAYDGRDFIAFDKG O73901 130 3 -
AHYQAAYDGSDYITLNED Q31166 136 4 -
GYNQYAYDGRDFIAFDKD Q9TQD5 130 3 -
AHYQAAYDGSDYITLNED Q62708 136 4 -
AHYQAAYDGSDYITLNED Q9QYV4 136 4 -
GYQRHAYDGLDYITLSED Q30428 142 4 -
GFDQHAYDGRDYIALDME Q30768 136 4 -
GFLQYAYDGQDFIIFNKD O19478 126 3 -
GFMQYAYDGGDFLSFDKD P79458 130 3 -
GFLQYAYDGQDFLIFNKD O97985 130 3 -
GFLQYAYDGQDFLIFNKD O97986 115 3 -
GFLQYAYDGQDFLIFNKD Q95460 130 3 -
GFLQYAYDGQDFLIFNKD Q9BCU2 130 3 -
GFLQYAYDGQDFLIFNKD Q9BCU3 130 3 -
GFLQYAYDGQDFLIFNKD Q9BCU4 130 3 -
GFLQYAYDGQDFLIFNKD Q9BD49 130 3 -
GFLQYAYDGQDFLIFNKD Q9BD50 130 3 -
GFLQYAYDGQDFLIFNKD Q9NPL2 130 3 -
GFLQYAYDGQDFLIFNKD Q9TQB9 126 3 -
GFFRDGWDGKDSIVFDKE O46838 124 3 -
GFFQYGWDGKDSMAFDKE O46829 124 3 -
GFFRDGWDGKDSIVFDKE O46837 124 3 -
GFFRDGWDGKDSIVFDKE O46846 124 3 -
GFFRDGWDGKDSIVFDKE O46847 124 3 -
GFFRDGWDGKDSMAFDKE O46828 124 3 -
GFLQYGWDGKNLISFDKE O46817 124 3 -
GFLQYGWDGKNVISFDKE O46830 124 3 -
GYSQFGYDGEDFISLDLK Q9GIW6 133 3 -
GFFRDGWDGKDSIVFDKE O46836 124 3 -
GFFRDGWDGKDSIVFDKE O46849 124 3 -
GFFRDGWDGKDSIVFDKE O46845 124 3 -
GFLQYGWDGKNVISFDKE O46818 124 3 -
GDFQYGYDGADFLSLDKS Q31499 129 3 -
GFFRDGWDGKDSIVFDKE O46843 124 3 -
GFFRDGWDGKDSIVFDKE O46841 124 3 -
GYYQYGYDGRDFIYLDTE Q9TP98 127 3 -
GYYQDSYDGEDFISLDLK O62896 133 3 -
GFFRDGWDGKDSIVFDKE O46835 124 3 -
GFFRDGWDGKDSIVFDKE O46839 124 3 -
GFFRDGWDGKDSIVFDKE O46844 124 3 -
GFFRDGWDGKDSIVFDKE O46848 124 3 -
GYEQHVYDGREFFALDTE Q9TPA6 128 3 -
GDFQLGYDGADFLSLDKS Q9GJB8 129 3 -
GDFQLGYDGADFLSLDKS Q9TNX1 129 3 -
GFFRDGWDAKDSIVFDKE O46840 124 3 -
GFFRDGWDAKDSIVFDKE O46885 124 3 -
GYEQHVYDGREFFALDTE Q08546 128 3 -
GYDQYAFDGRDFLAFDMD Q9BCW3 129 3 -
GFVQHAWDSTDFISLDKD Q9MX69 125 4 -
GFFQYGWDGKNLISFDKE O46820 124 3 -
GFYQDGWDGKDYINFDKE O19481 129 3 -
GFYQYGWDGKNLISFDKE O46831 124 3 -
GFFQYGWDAKNVISFDKE O46825 124 3 -
GFFQFGWDGKNLISFDKE O46886 124 3 -
GYEQFGYDGREFIALDTE Q9TPA1 128 3 -
GFFRDGWDAKDSIVFDKE O46842 124 3 -
GFFQYGWDGKNLISFDKE O46832 124 3 -
GFLQYGWDAKNVISFDKE O46822 124 3 -
GYNQYGYDGKEFIALDTE Q9TPA0 128 3 -
GFLQYGWDAKDFVSFDKE O46821 124 3 -
GFVQYGWDAKDFVSFDKE O46827 124 3 -
GYDQYGYDGEDFISLDLK O62894 133 3 -
GYDQYGYDGEDFISLDLK O62895 133 3 -
GFVQFGWDAKDFVSFDKE O46826 124 3 -
GFFQFGWDAKDFVSFDKE O46824 124 3 -
GYDQCGYDGREFIALDTE Q9TPA2 128 3 -
GYMQYGYDGEDFLSLDKS O97982 124 3 -
GFFQYGYDGEDFLALDLK Q9TNN8 130 4 -
GYSQDGYDGEDFIAFDLK Q9GIJ3 128 4 -
GYSQDGYDGEDFIAFDLK Q9GJB9 128 4 -
GYEQHVYDGREFFALDTE Q9TPA5 91 3 -
GYDQHVYDGREFFALDTE Q9TPA4 128 3 -
GFLQFGWDAKDFVSFDKE O46823 124 3 -
GFFQFGWDAKNVISFDKE O46819 124 3 -
GFFQYGWDAKDFVSFDKE O46834 124 3 -
GFVQFGWDAKNVISFDKE O46833 124 3 -
GYEQYGYDGREFFALDTE Q9TPA3 128 3 -
GYMQYGYDGEDFLSLDKS Q31387 124 3 -
GYYQYGYDGRDFMYLDTE Q9TP99 127 3 -
GSYRNGYDGRDFIFFKLG O98191 134 3 -
GSYRNGYDGRDFIFFKLG O98192 134 3 -
GDFQLGYDGADFLSLDKS Q9MX28 121 3 -
GHWQYGYDGEDFISFDKN Q9XRX0 124 3 -
GHWQYGYDGWDYLTLDLD Q62585 141 3 -
SYHQYGYDGREFIALDTE Q9TPA7 128 3 -
GFYQYGYDGEDFIALDLK Q9TNN4 130 4 -
GSERFGYDGRDFISFDLE O98187 134 3 -
GTYRNGYDGRDFISFELG O98189 134 3 -
GHYRLTYYGYDYLTLNED O19443 136 4 -
GFNQYGWDGRDFLSFDKD O19480 124 3 -
GSERFGYDGRDFISFDLE O98188 134 3 -
GYSQYGYDGEDFISLDLK Q9GIW7 133 3 -
GHWQYGYDGSDYLTLDLG Q31129 134 2 -
GSERHGYDGRDFISFDLE O98193 134 3 -
WYDQLAFDGVDHPTLNKD Q31277 142 4 -
GFEQWGYDGEDFIAFDLK Q31594 128 4 -
GFVQHGYDGEGFIAFDLK P79570 130 4 -
WYNQLAYDSEDLHTLNEN Q31208 137 4 -
WYNQLAYDSEDLPTLNEN Q31615 137 4 -
WYNQLAYDSEDLPTLNEN Q9BCZ1 137 4 -
GYEQFGYDGEDFLSLDLE O98272 129 4 -
GFYQFGYDGEDFIAFDLK Q9GJC2 128 4 -
WYNQLAYDSEDLPTLSEN Q31206 137 4 -
SFHQYGYDGEDFIALDLK Q9XR30 128 4 -
VHWQIGYDGEDFISLDKK Q31365 126 3 -
GFNQYGYDGEDFIAFDLK Q9GJC0 122 4 -
GFNQYGYDGEDFIAFDLK Q9TNW9 122 4 -
GFDQYGYDGADFISFKLK Q9GJE4 131 4 -
GFNQHGYDGEDFIAFDLK Q9GJC1 130 4 -
AVWRYAYDGEDFIEFNKE Q9DBB7 128 3 -
AVWRYAYDGEDFIEFNKE ZA2G_MOUSE 128 3 -
AFWKYYYDGKDYIEFNKE O60386 133 3 -
AFWKYYYDGKDYIEFNKE ZA2G_HUMAN 130 3 -
GFWKYGYDGQDHLEFCPE Q9GL43 134 3 -
AVWRYAYDGEDFIEFNKE ZA2G_RAT 128 3 -
GFRQDGYDGADFISFKLK O46706 131 4 -
GFWRYGYDGQDHLEFCPK HFE_MOUSE 146 3 -
GFWRYGYDGQDHLEFCPK Q9D754 146 3 -
GLEQFGYNGEDFLAFDLT Q9XR31 128 4 -
GFWKYGYDGQDHLEFCPE Q9GKZ0 134 3 -
GFWKYGYDGQDHLEFCPE Q9GL42 134 3 -
GFWMYGYDGQDHLEFCPE Q9GL41 134 3 -
GYWKYGYDGQDHLEFCPD HFE_HUMAN 134 3 -
GYWKYGYDGQDHLEFCPD O75929 134 3 -
GIDQYAYDGEDFLSFDKE Q9TP04 132 2 -
AFMELLFDTHDYITLNED O19442 136 4 -
GFFQDGYDGADFISFKLK O46705 131 4 -
GFWKYGYDGQDHLEFCPK HFE_RAT 147 3 -

Motif 4 width=19
Element Seqn Id St Int Rpt
RAYLEGTCVEWLRRYLENG 1C12_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1C13_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q9TNR4 150 27 -
RAYLEGTCVEWLRRYLENG Q9TNN7 181 27 -
RAYLEGTCVEWLRRYLENG Q9TPX2 181 27 -
RAYLEGTCVEWLRRYLENG O78179 181 27 -
RAYLEGTCVEWLRRYLENG Q9MY34 181 27 -
RAYLEGECVEWLRRYLENG 1C04_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG O78214 181 27 -
RAYLEGTCVEWLRRYLENG Q29862 181 27 -
RAYLEGTCVEWLRRYLENG O19617 181 27 -
RAYLEGTCVEWLRRYLENG Q95463 181 27 -
RAYLEGTCVEWLRRYLENG Q9GIK4 181 27 -
RAYLEGECVEWLRRYLENG Q31603 181 27 -
RAYLEGECVEWLRRYLENG Q29961 181 27 -
RAYLEGECVEWLRRYLENG Q29767 181 27 -
RAYLEGLCVEWLRRYLENG 1B44_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1C15_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXM0 181 27 -
RAYLEGECVEWLRRYLENG 1B19_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG P79490 181 27 -
RAYLEGLCVEWLRRYLENG Q9UIP6 181 27 -
RAYLEGLCVEWLRRYLENG 1B11_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q95343 181 27 -
RAYLEGLCVEWLRRYLENG Q9MYC0 181 27 -
RAYLEGTCVEWLRRYLENG 1B39_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG P79489 181 27 -
RAYLEGTCVEWLRRYLENG P79555 181 27 -
RAYLEGTCVEWLRRYLENG Q29848 181 27 -
RAYLEGLCVEWLRRYLENG 1C01_GORGO 181 27 -
RAYLEGTCVEWLRRYLENG Q31627 181 27 -
RAYLEGLCVEWLRRYLENG Q9BD06 181 27 -
RAYLEGECVEWLRRYLENG 1B02_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1B38_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG Q29638 181 27 -
RAYLEGLCVEWLRRYLENG Q08173 181 27 -
RAYLEGTCVEWLRRYLENG 1C11_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q9TQP9 181 27 -
RAYLEGTCVEWLRRYLENG Q29652 181 27 -
RAYLEGLCVEWLRRYLENG 1C02_GORGO 181 27 -
RAYLEGLCVEWLRRYLENG 1C04_GORGO 181 27 -
RAYLEGECVEWLRRYLENG Q29854 181 27 -
RAYLEGECVEWLRRYLENG Q31610 181 27 -
RAYLEGECVEWLRRYLENG Q31613 181 27 -
RAYLEGECVEWLRRYLENG 1B34_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG 1B46_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXC8 181 27 -
RAYLEGLCVEWLRRYLENG Q30173 181 27 -
RAYLEGTCVEWLRRYLENG 1C16_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG O78211 181 27 -
RAYLEGTCVEWLRRYLENG Q29963 181 27 -
RAYLEGLCVEWLRRYLENG 1B48_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9GIZ0 181 27 -
RAYLEGLCVEWLRRYLENG Q29982 181 27 -
RAYLEGECVEWLRRYLENG Q29681 181 27 -
RAYLEGECVEWLRRYLENG Q29861 181 27 -
RAYLEGTCVEWLRRYLENG 1B04_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1C02_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG Q9MXH3 181 27 -
RAYLEGLCVEWLRRYLENG Q29943 181 27 -
RAYLEGECVEWLRRYLENG Q29693 181 27 -
RAYLEGECVEWLRRYLENG 1B36_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG P79549 181 27 -
RAYLEGLCVEWLRRYLENG Q29981 181 27 -
RAYLEGLCVEWLRRYLENG O19790 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXH4 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXC9 181 27 -
RAYLEGECVEWLRRYLENG 1C03_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1C17_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG O78178 181 27 -
RAYLEGTCVEWLRRYLENG Q29641 181 27 -
RAYLEGTCVEWLRRYLENG Q30192 181 27 -
RAYLEGTCVEWLRRYLENR 1C14_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG 1B59_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXI1 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXK3 181 27 -
RTYLEGTCVEWLRRYLENG 1B32_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG Q29705 181 27 -
RAYLEGECVEWLRRYLENG 1B14_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG 1B18_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG O78189 181 27 -
RAYLEGLCVEWLRRYLENG Q29748 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXL6 181 27 -
RAYLEGTCVEWLRRYLENG Q9UQS9 181 27 -
RAYLEGTCVEWLRRYLENG O02865 181 27 -
RTYLEGTCVEWLRRYLENG Q29836 181 27 -
RAYLEGECVEWLRRYLENG Q29855 181 27 -
RAYLEGECVEWLRRYLENG Q9TPW6 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXK4 181 27 -
RAYLEGTCVEWLRRYLENG 1A34_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXD0 181 27 -
RAYLEGTCVEWLRRYLENG 1B02_PANTR 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXK0 181 27 -
RAYLEGECVEWLRRYLENG Q29846 181 27 -
RAYLEGECVEWLRRYLENG P79612 181 27 -
RAYLEGTCVEWLRRYLENG Q29864 181 27 -
RAYLEGTCVEWLRRHLENG 1B07_HUMAN 181 27 -
RAYLEGTCVEWLRRHLENG 1B08_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q29959 181 27 -
RAYLEGTCVEWLRRYLENG Q29960 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXH2 181 27 -
RAYLEGECVEWLRRYLENG Q29842 181 27 -
RAYLEGLCVEWLRRYLENG O46684 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXD2 181 27 -
RAYLEGLCVEWLRRYLENG Q9TPL2 181 27 -
RAYLEGTCVEWLRRYLENG O78083 181 27 -
RAYLEGTCVEWLRRYLENG Q95603 181 27 -
RTYLEGTCVEWLRRYLENG Q29749 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXH5 181 27 -
RAYLEGLCVEWLRRYLENG Q9XRY3 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXC6 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXG6 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXI2 181 27 -
RAYLEGTCVEWLRRYLENG Q9TPL5 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXL9 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXL7 181 27 -
RAYLEGLCVEWLRRYLENG 1B10_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG 1B20_HUMAN 157 27 -
RTYLEGTCVEWLRRYLENG 1B31_HUMAN 181 27 -
RTYLEGTCVEWLRRYLENG Q29847 181 27 -
RAYLEGTCVEWLRRYLENG 1C07_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q29921 181 27 -
RAYLEGTCVEWLRRYLENG Q29865 181 27 -
RAYLEGTCVEWLRRYLENG P79498 181 27 -
RAYLEGTCVEWLRRYLENG 1B29_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXM1 181 27 -
RAYLEGECVEWLRRYLENG 1B45_HUMAN 181 27 -
RAYLEGECVEWLRRYLENG Q9GIL3 181 27 -
RAYLEGLCVEWLRRYLENG 1B12_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q29844 181 27 -
RAYLEGLCVESLRRYLENG Q30172 181 27 -
RAYLEGECVEWLRRYLENG Q9TP95 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXH1 181 27 -
RTYLEGTCVEWLRRYLENG Q29852 181 27 -
RAYLEGLCVEWLRRYLENG 1CXX_HUMAN 157 27 -
RAYLEGTCVEWLRRYLENG Q9MXH0 181 27 -
RAYLEGRCVEWLRRYLENG 1A66_HUMAN 181 27 -
RAYLEGTCVEWLRRHLENG Q9BCM6 181 27 -
RAYLEGRCVEWLRRYLENG P79563 181 27 -
RAYLEGECVEWLRRYLENG 1B15_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG 1B25_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1C01_HUMAN 181 27 -
RAYLEGLCVEWLRRYLKNG Q29992 181 27 -
RAYLEGTCVEWLRRHLENG 1B13_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG 1C03_GORGO 181 27 -
RAYLEGTCVEWLRRYLENG 1B55_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1B56_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1B57_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG P79523 181 27 -
RAYLEGLCVEWLRRYLKNG 1C06_HUMAN 181 27 -
RAYLEGLCVEWLRRHLENG O19554 181 27 -
RAYLEGLCVESLRRYLENG 1B43_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG O78172 181 27 -
RAYLEGTCVEWLRRYLENG Q29637 181 27 -
RAYLEGLCVEWLRRYLENG Q31602 181 27 -
RAYLEGLCVEWLRRYLENG Q9GIX2 181 27 -
RAYLEGLCVEWLRRYLKNG Q9GIK8 181 27 -
RAYLEGRCVEWLRRYLENG 1A26_HUMAN 181 27 -
RAYLEGRCVEWLRRYLENG Q95377 181 27 -
RAYLEGRCVEWLRRYLENG Q9MY52 181 27 -
RAYLEGECVEWLRRYLENG 1B35_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q31605 181 27 -
RAYLEGTCVEWLRRYLENG Q29747 181 27 -
RAYLEGLCVEWLRRYLENG 1B58_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG Q9BCM7 181 27 -
RAYLEGLCVEWLRRYLENG Q9TPL4 181 27 -
RAYLEGECVEWLRGYLENG Q95604 181 27 -
RAYLEGECVEWLRRYLENG 1B16_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG O78218 181 27 -
RAYLEGLCVEWLRRYLENG 1B47_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1C18_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG O78165 181 27 -
RAYLEGLCVEWLRRYLENG Q29644 181 27 -
RAYLEGTCVEWLRRYLENG 1A74_HUMAN 181 27 -
RAYLEGQCLEWLRRYLENG Q9TNR1 157 27 -
RAYLEGLCVEWLRRYLKNG 1C05_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q29932 181 27 -
RAYLEGTCVEWLRRHLENG Q29845 181 27 -
RAYLEGRCVEWLRRYLENG Q9MW42 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXK9 181 27 -
RAYLEGTCVEWLRRYLENG 1A02_PANTR 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXI3 181 27 -
RAYLEGTCVEWLRRYLENG 1B01_GORGO 181 27 -
RAYLEGLCVEWLRRYLENG 1B22_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG O19755 181 27 -
RAYLEGLCVEWLRRYLENG Q29669 181 27 -
RAYLEGRCVEWLRRYLENG 1A11_HUMAN 181 27 -
RAYLEGRCVEWLRRYLENG Q9BCN0 181 27 -
RAYLEGRCVEWLRRYLENG Q9MYI5 181 27 -
RAYLEGRCVEWLRRYLENG Q9TQP6 181 27 -
RAYLEGRCVEWLRRYLENG Q9TQP7 181 27 -
RTYLEGTCVEWLRRYLENG Q29858 181 27 -
RAYLEGLCVEWLRRYLENG 1B23_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXC7 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXG5 181 27 -
RTYLEGTCVEWLRRYLENG Q29697 181 27 -
RAYLEGTCVEWLRRYLENG 1B03_GORGO 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXD1 181 27 -
RAYLEGECVEWLRRYLENG Q29700 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXK1 181 27 -
RTYLEGTCVEWLRRYLENG Q29935 181 27 -
RAYLEGTCVEWLRRYLENG 1A03_GORGO 181 27 -
RAYLEGLCVEWLRRYLENG 1B21_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG 1B27_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG 1B28_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9MY33 181 27 -
RAYLEGLCVEWLRRYLENG 1B26_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1B02_GORGO 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXH7 181 27 -
RAYLEGLCVDGLRRYLENG Q29633 181 27 -
RAYLEGLCVDGLRRYLENG Q29985 181 27 -
RAYLEGLCVEWLRRYLENG 1B04_GORGO 181 27 -
RAYLEGLCVEWLRRYLENG Q29911 181 27 -
RAYLEGTCVEWLRRYLENG Q29991 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXI0 181 27 -
RAYLEGTCVEWLRRYLENG 1A30_HUMAN 181 27 -
RAYLEGLCVEWLRRHLENG 1B63_HUMAN 181 27 -
RAYLEGRCVEWLRRYLENG 1A25_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG 1A01_PANTR 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXH6 181 27 -
RAYLEGLCVEWLRRYLENG O78180 181 27 -
RAYLEGRCVEWLRRYLENG 1A43_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q9TPL7 181 27 -
RAYLEGECVEWLRRYLENG 1A02_GORGO 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXM7 181 27 -
RTYLEGTCVEWLRRYLENG Q95365 181 27 -
RAYLEGLCVEWLRRHLENG Q29924 181 27 -
RAYLEGRCVEWLRRYLENG 1A03_PANTR 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXK5 181 27 -
RAYLEGECVEWLRRYLENG 1B05_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG Q9MYB8 181 27 -
RAYLEGLCVESLRRYLENG 1B41_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG 1B42_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG P79524 181 27 -
RAYLEGLCVESLRRYLENG Q29850 181 27 -
RAYLEGLCVEWLRRYLENG Q29661 181 27 -
RAYLEGLCVEWLRRYLENG Q29857 181 27 -
RAYLEGTCVEWLRRYLEHG O19446 181 27 -
RAYLEGTCVEWLRRYLEHG Q31266 171 27 -
RAYLEGLCVEWLRRYLENG Q9MXM2 181 27 -
RAYLEGECVEWLRRHLENG Q31612 181 27 -
RAYLEGLCVESLRRYLENG Q9XRX9 181 27 -
RAYLEGTCVEWLRRHLENG Q30719 181 27 -
RAYLEGTCVEWLRRHLENG 1A01_GORGO 181 27 -
RAYLEGECLEWLRRYLENG Q30720 178 27 -
RAYLEGTCVEWLRRYLENG Q9MXJ9 181 27 -
RAYLEGTCVEWLRRYLENG 1A32_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q9GJ44 181 27 -
RAYLEGTCVEWLRRYLENG Q9GJ45 181 27 -
RAYLEGLCVEWLRRYLKNG Q29993 181 27 -
RAYLEGTCVEWLRRHLENG Q9MXG3 181 27 -
RAYLEGLCVESLRRYLENG Q9MYC3 181 27 -
RVYLEGTCVEWLRRYLENG 1A36_HUMAN 181 27 -
RAYLEGQCLEWLRRYLENG Q9TNR2 157 27 -
RAYLEGTCVEWLRRYLENG 1A31_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG Q9UQS8 181 27 -
RAYLEGLCVEWLRRYLENG Q29941 181 27 -
RAYLEGTCVEWLRRYLENG Q30712 181 27 -
RAYLEGLCVEWLRRYLENG Q9MXM4 181 27 -
RAYLEGTCVEWLRRYLENG 1A68_HUMAN 181 27 -
RAYLEGLCVESLRRYLENG 1A01_PONPY 181 27 -
RAYLEGTCVEWLRRYLENG Q29940 181 27 -
RAYLEGTCVEWLRRYLENG 1A04_PANTR 181 27 -
RAYLEGTCVEWLRRYLENG Q9MYG5 181 27 -
RAYLEGTCVEWLRRYLENG Q9TPL6 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXH8 181 27 -
RAYLEGTCVEWLRRYLENG Q30711 178 27 -
RAYLEGTCVEWLRRYLENG Q30716 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXH9 181 27 -
RAYLEGTCVEWLRRYLENG Q9UIN2 181 27 -
RAYLEGLCVESLRRYLENG Q29849 181 27 -
RAYLEGTCVEWLHRYLENG 1A01_SAGOE 181 27 -
RAYLEGLCVEWLRRHLENG 1B53_HUMAN 181 27 -
RNYLEGTCVEWLRRYLENG Q30287 156 27 -
RAYLEGTCVEWLRRYLENG Q9MXL0 181 27 -
RAYLDGTCVEWLRRYLENG 1A03_HUMAN 186 27 -
RAYLDGTCVEWLRRYLENG Q9MYG4 181 27 -
RAYLDGTCVEWLRRYLENG O19756 181 27 -
RNYLEGRCVEWLRRYLENG Q95394 181 27 -
RAYLEGLCVEWLRRYLENG Q29925 181 27 -
RAYLEGLCVEWLRRYLENG 1B54_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXI8 181 27 -
RAYLEGTCVEWLRRYLENG Q9TPL3 181 27 -
RAYLEGTCVEWLRRYLENG Q30988 181 27 -
RAYLEGTCVEWLRRYLENG Q9TQB6 181 27 -
RAYLEGLCVEWLRRHLENG Q29938 181 27 -
RAYLEDLCVESLRRYLENG Q29718 181 27 -
RAYLEGTCVEWLRRHLENG 1A33_HUMAN 181 27 -
RAYLEGLCVEWLRRHLENG 1B49_HUMAN 181 27 -
RAYLEGLCVEWLRRHLENG O78173 181 27 -
RAYLEGLCVDGLRRYLENG Q9MXM3 181 27 -
RACLEGECVEWLRRYLENG Q9GIY5 181 27 -
RAYVEGECVDWLRRYLEHG Q9BD51 181 27 -
RAYLEGECLEWLRRHLENG Q30718 181 27 -
RAYLEGLCVEWLRRYLENG Q9MWK4 181 27 -
RTYLEGECLEWLRRYLENG Q9GJ78 181 27 -
RAYLEGLCVEWLRRHLENG 1B52_HUMAN 181 27 -
RNYLEGTCVESLRRYLENG Q30482 178 27 -
RAYLEGTCVEWLRRYLENG 1A29_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXK7 181 27 -
RAYLEGRCVEWLRRYLEKG Q30595 178 27 -
RAYMEGTCVEWLRRHLENG 1OKO_GORGO 181 27 -
RAYLEGLCVEWLRRYLENG 1B62_HUMAN 181 27 -
RAYLEGLCVDGLRRYLENG Q30900 181 27 -
RAYLEGLCVEWLRRYLENG 1B61_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG P79496 181 27 -
RAYLEGLCVEWLRRYLKNG Q29988 181 27 -
RAYLEGTCVEWLRRYLENG Q9MXL8 181 27 -
RAYLEGTCVDGLRRYLENG Q9MXM6 181 27 -
RAYLEGTCVEWLRRYLENG 1A04_GORGO 181 27 -
RAYLEGLCVEWLRRYLENG 1B60_HUMAN 181 27 -
RAYLEGLCVEWLRRYLENG Q9MYI6 181 27 -
RAYLEGRCVEWLRRYLENG Q30868 181 27 -
RAYLEGECVEWLRRYLKNG Q31142 178 27 -
RAYLEGRCVEWLRRYLENG Q9BCY9 181 27 -
RAYLEGKRVESCRRYLENG 1C01_PANTR 181 27 -
RAYLEGRCVDGLRRYLENG Q9MXM5 181 27 -
RVYLEGEFVEWLRRYLENG HLAH_HUMAN 181 27 -
RAYLEGLCVDGLRRYLENG Q9MXI6 181 27 -
RAYLEGTCVEWLRRYLENG 1A02_HUMAN 181 27 -
RAYLEGTCVEWLRRYLENG O78126 178 27 -
RAYLEGTCVEWLRRYLENG P79603 181 27 -
RAYLEGTCVEWLRRYLENG Q9MYB7 181 27 -
RAYLEGTCVEWLRRYLENG Q9TQ73 181 27 -
RAYLEGRCVKSLRRYLENG Q9XRY2 181 27 -
RAYLEGRCVESLRRYLENG Q9MXL4 181 27 -
RAYLEGECVEWLRRYLENG Q30871 181 27 -
RAYLEGECVEWLRRYLENG Q9BCY7 181 27 -
RNYLEGTCVEWLLRYLEIG Q30485 178 27 -
RAYLEGTCVEWLRRHLENG 1C01_SAGOE 181 27 -
RAYLEGECVDGLRRYLENG 1A80_HUMAN 181 27 -
RAYLEGTCVDGLRRYLENG Q9MXJ2 181 27 -
RAYLEGACVEWLRRYLERG Q31172 178 27 -
RAYLEGECVEWLPRYLENG Q9MXS5 181 27 -
RAYLEGRCVEWLRRYLEKG Q9MXQ3 181 27 -
RASLEGTCVEWLRRYLENG Q30901 181 27 -
RNYLEGRCVEWLRRYLENG O77975 178 27 -
RAYLEGECLEWLRRYLENG Q30591 153 27 -
RAYLEGTCVEWLSRYLELG HA12_RAT 181 27 -
RAYLEGECVEWLHRYLKNG Q31196 176 27 -
RVYLEGRCVDGLRRYLENG 1A01_HUMAN 181 27 -
RAYLEGQCVEWLPRYLESG Q9TNR3 157 27 -
RAYLEGTCVEWLHRYLENG 1B01_SAGOE 181 27 -
RAYLEGECVEWLHRYLKNG HA1L_MOUSE 181 27 -
RAYLEGLCVDSLRRYLEHG Q9BD53 181 27 -
RAYLEGTCVEWLRRYLEHG Q31254 178 27 -
RAYLEGTCVEWLRRYLENG Q9TQ65 181 27 -
RAYLEGTCVEWLRRYLENG Q29757 181 27 -
RAYLEGRCVEWLRRYLEKG Q9MXR5 181 27 -
RAYLEGRCVEWLRRYLEKG Q9MXS3 181 27 -
RNYLEGTCVEWLRRYLENG Q30291 178 27 -
RAYLEGKCLEWLRRYLENQ Q30715 181 27 -
RNYLEGTCVESLLRFLENG Q9GIW5 181 27 -
RVYLEGTCVEWLRRYLENG Q9TQ74 181 27 -
RTYLEGECLEWLRRHLENG Q30870 181 27 -
RTYLEGECLEWLRRHLENG Q9BCZ0 181 27 -
RAYLQGQCLEWLRRYLENG Q30714 113 27 -
RNYLEGECVEWLRRYLENG HA1A_BOVIN 178 27 -
RSYVEGRCVEWLRRYLENG Q9TNR0 157 27 -
RAYLEGACVEWLRRYLQLG Q31149 181 27 -
RSYLEGACVEWLQKYLEMG O19242 178 27 -
RNYLEGTCVEWLRRYLENG Q95393 178 27 -
RTYLEGECLEWLRRYLENG Q30592 153 27 -
RAYVEGTCVESLRRYLEHG Q31255 178 27 -
RAYLEGTCVEWLRRYLELG HA13_MOUSE 181 27 -
RAYLEDTCVEWLRRYLENG Q9BCY4 175 27 -
RAYLEGTCVDGLRRYLENG Q29907 181 27 -
RAYLEGTCVEWLRRYLQLG HA1K_MOUSE 178 27 -
RAYLEGTCVEWLRRYLQLG Q95458 178 27 -
RAYLEGTCVEWLRRYLELG Q31188 181 27 -
RAYLEGRCVDGLRRYLENG Q9MXK6 181 27 -
RAYLEGACVEWLSRHLKNG HA1W_MOUSE 178 27 -
RAYLEGTCVEWLRRYLQLG Q31173 178 27 -
RAYVEGRCVDWLRRYLEHG Q9BD52 181 27 -
RNYLEGRCVEWLLRYLENG Q30483 178 27 -
RAYLEGTCVEWLRRYLKNG HA1B_MOUSE 178 27 -
RAYLEGTCVEWLRRYLELG Q61895 178 27 -
RAYLEGTCVEWLHRYLENG HLAG_HUMAN 181 27 -
RAYLEGTCVEWLHRYLENG Q9TP69 178 27 -
RAYLEGTCVEWLHRYLENG Q30182 181 27 -
RAYLEAECVEWLLRYLELG Q31214 181 27 -
RAYLEAECVEWLRRHLELG Q61896 178 27 -
RAYLEGRCVEWLRRYLEKG Q30721 181 27 -
RNYLETTCVEWLRRYLEMG HA19_CANFA 182 28 -
RAYLESGCVEWLRRYLELG Q31155 181 27 -
RAYLEGECVEWLRRYLELG Q61894 178 27 -
RNYLEGRCVEGLRRYLENG O77976 178 27 -
RAYLDGECVEWLLRYLENG Q30488 177 27 -
KAYLEGTCVEWLLRYLELG Q31170 181 27 -
RAYLEGVCVEWLLRYLKNG Q61642 178 27 -
RAYLEGVCVEWLLRYLKNG Q64272 178 27 -
RAYLEGECVEWLRRYLKNG HA12_MOUSE 181 27 -
RAYLEGECVEWLLRHLKNG Q61892 181 27 -
RAYLEGTCVEWLGRYLEHG Q9JHN5 177 27 -
RAYLEGACVEWLRRYLELG HA14_MOUSE 178 27 -
RAYLEGTCVDGLRRYLENG Q29689 181 27 -
RSYLEGECVEWLRRYLEDG Q30849 178 27 -
RIYLEGKCVEWLRRYLVTG Q30290 180 27 -
RAYLEGTCVEWLGRYLEHG Q9JHN7 177 27 -
RAYLEGTCVEWLLRYLERG HA11_RAT 181 27 -
RAYLEGTCVESLRRYLELG Q95457 181 27 -
RAYLEGTCVDGLRRYLENG 1A23_HUMAN 181 27 -
RAYLEGTCVDGLRRYLENG Q9MY72 181 27 -
RAYLEGTCVDGLRRYLENG Q9BCN1 181 27 -
RAYLEGTCVDGLRRYLENG O15506 181 27 -
RAYLEGTCVDGLRRYLENG 1A24_HUMAN 181 27 -
RAYLEGACVEWLPRHLKNG Q61893 178 27 -
RNYLEGECVEWLRRYLENG HA1B_BOVIN 184 27 -
RNYLEGECVEGLRRYLENG O78186 178 27 -
RNYLETTCVEWLRRYLEMG O46882 181 27 -
RTYLEGECLEWLGRYLENG O02948 181 27 -
RAYLEGTCVEWLRRHLKNG Q61891 181 27 -
RAYLEGTCVEWLGRYLEHG Q9JHN4 177 27 -
RNYVEGECVEGLRRYLENG Q30289 181 27 -
RAYLEGTCVEWLLRHLKNG Q31169 181 27 -
RSYLQGLCVEGLRRYLEMG O19240 181 27 -
RAYLEAECVEWLLRYLELG HA10_MOUSE 178 27 -
SAYLEGECLEWLRRHLENG Q30869 181 27 -
RNYLEGRCVEGLRRYLENG Q95395 181 27 -
RNYLEGRCVEGLRRYLENG Q95477 181 27 -
RSYLQGRCVEWLRRYLEMG O19243 181 27 -
RSYLQGLCVESLRRYLEMG O19244 178 27 -
RSYLQGLCVESLRRYLEMG Q31066 178 27 -
RSYLQGLCVESLRRYLEMG Q31067 178 27 -
RAYVEGRCVEWLRRYLENG Q9BCY8 181 27 -
RAYLEDTCVEWLRRYLENG Q30593 175 27 -
KAYLQGTCVEWLRRYLELG O19445 178 27 -
KAYLQGTCVEWLRRYLELG Q08680 178 27 -
RNYVEGRCVEGLRRYLENG O77977 178 27 -
RAYLEGECVEWLRRYLELG HA1D_MOUSE 178 27 -
RAYLEGECVEWLRRYLELG O35641 178 27 -
RAYLEGECVEWLRRYLELG Q31191 166 27 -
RAYLEGECVEWLRRYLELG Q31634 178 27 -
RAYLEGECVEWLRRYLELG Q31148 178 27 -
RAYLEGECVEWLRRYLELR Q31267 178 27 -
KAYLEGECVESLRRYLELG Q31141 178 27 -
RAYLEGTCVEWLHRYLENG Q9MYA2 181 27 -
KAYMEGECVQSLRRYLELG Q31218 178 27 -
RAYLEGECPEWLRRYMENQ Q30713 178 27 -
KAYLEGTCLESLRRYLELG Q31256 178 27 -
KAYLEGTCLESLRRYLELG Q95577 178 27 -
RNYLEGRCVESLRRYLENG Q95480 177 27 -
RAYLEGTCVEWLGRHLEHG Q9JHN3 177 27 -
RAYLEGECMEWLRRYLENG Q95559 178 27 -
RAYLEGECVEWLRRYLELG P79588 178 27 -
RSYLQGLCVEGLQKYLQMG Q9TSW1 181 27 -
RSYLQGLCVEGLQKYLQMG Q9TSW2 181 27 -
RNYVEGRCVEGLRRYLENG O77973 181 27 -
KAYLEGECVEWLRRYLELG Q31614 178 27 -
RTYLEGECLELLRRYLENG 1C28_PANTR 178 27 -
RSYLQGTCVEWLQKYLQMG O19245 181 27 -
RNYLDGECVEWLLRHLENG Q30481 181 27 -
RSYLEGACVVWLQKYLEMG Q9TSW3 178 27 -
RSYLEGACVVWLQKYLEMG Q9TSW4 178 27 -
KAYLEGECVEWLHRYLKNG HA11_MOUSE 181 27 -
RAYLERECVEWLRRYLEMG HA1A_RABIT 181 27 -
RAYLERECVEWLRRYLEMG HA1B_RABIT 181 27 -
RAYLEDTCVEWLHKYLEKG Q9GIY8 178 27 -
RAYLEETCVESLRRHLEKG Q9MXS4 181 27 -
RNYVEGRCVEGLRRYLENG O77974 181 27 -
RNYAEGRCMEGLRRYLENG O98028 181 27 -
RAHLEGTCVEWLRRHLEKG Q9BCY5 178 27 -
RNYVEGRCVEGLRRYLENG O77972 178 27 -
RTYLEGECLELLRRYLENG HLAF_HUMAN 178 27 -
RTYLEGECLELLRRYLENG Q9TP68 178 27 -
RNYVEGTCVECVRRYLEIG Q30838 185 27 -
RNYLETTCVEWLRRYLEMG O46880 178 27 -
RSYLQGRCVEGLRRYLQMG O19241 178 27 -
RSYLQGRCVEGLRRYLQMG Q9TQ85 178 27 -
RAYLEGECVEWLRRYLELG P79587 178 27 -
RSYLQGLCVESLREYLEMG O19075 178 27 -
RNYLEGTCVESLLRFLENG Q95479 181 27 -
KAYLEGKCLESLLRYLELG P79589 178 27 -
RAYLEGTCVEWLGRYLEHG Q9JHN6 177 27 -
RTYLEGECLELLRRYLENG HLAF_MACMU 180 27 -
RAYLEGRCFYWLRRYLENG P70466 181 27 -
RAYLEDTCVEWLHKYLEKG HLAE_HUMAN 178 27 -
RAYLEDTCVEWLHKYLEKG Q9GIY7 178 27 -
RAYLKGTCVESLRRYLELR Q31271 181 27 -
RTYLEGECVESLRRYLENG Q9BCY6 178 27 -
RSYLQGTCVEWLQKYLQMG Q31068 181 27 -
RSYLQGTCVEWLQKYLQMG Q31069 181 27 -
RAYLEGECVESLRRYLEIW Q95558 180 27 -
RAYLEGECVEWLRSYLAPR Q9JHM2 178 27 -
RAYLDGTCVEWLRRYLENG Q29840 179 27 -
KASLEGRCVEWLRRYLENG Q95560 177 27 -
RAYLQGPCVEWLHRYLRLG HA15_MOUSE 177 27 -
RAYLEDTCVEWLHKYLEKG Q30171 176 27 -
QAYLEGTCMQSLRRYLQLG HA17_MOUSE 178 27 -
RAYLEDECVQWLRRYLENR Q31246 180 27 -
RAYLKGTCVESVRRYLELR O77949 181 27 -
RNYLEGTCVEWLAKYLDMG Q95481 181 27 -
RNYLEGTCVEWLAKYLDMG Q95483 181 27 -
RNYLQGTCVEWLAKYLDMG Q95486 181 27 -
RAYLQGPCVEWLHRYLQLG O98032 177 27 -
RNYLEGTCVEWLLRHLENG Q30484 181 27 -
RNYLEGTCVEWLAKYLDMG Q30493 181 27 -
RAYLQGPCVEWLHTYLRLG Q31153 177 27 -
RAYLQGPCVEWLHTYLRLG Q9QYQ4 177 27 -
RAYLQGPCVEWLHIYLRLG Q9TQB1 177 27 -
RNYLEGTCVEWLAKYLDMG Q95487 181 27 -
RNYLEGTCVKWLSRYLENG Q30486 181 27 -
RAYLEGACVQSLRRYLQLR HA18_MOUSE 178 27 -
RAYLEGACVQSLRRYLQLR P79567 178 27 -
RAYLEGACVQSLRRYLQLR P79568 178 27 -
RNYLEGLCVESLAKYLDMG Q95482 181 27 -
KFYLEGECVEWLRRYLELG O19440 178 27 -
RAYLQGPCVEWLHTYLHLG O78105 177 27 -
KSYLEGTCVEWLRRYLENG Q9TNZ1 176 27 -
KAYLEGKCMVWLSRHLEQG Q05081 178 27 -
RAYLEGECVESLHRYLELG O77950 181 27 -
RAYLQSTCIEWLKKYLELG Q95557 176 27 -
RSYLQGLCVEGLQKYLEMG Q9TSW5 178 27 -
RSYLQGLCVEGLQKYLEMG Q9TSW6 178 27 -
RTYLEGKCLMWLHRYLELG O19441 178 27 -
RTYLEGKCLMWLHRYLELG Q31215 178 27 -
EDFLKGECVKRLLDYLELG Q31216 181 27 -
KNYLEATCVEWLRRYVEYG O46792 175 27 -
RVYLQGECVQSLLKYLERG O46881 181 27 -
RAYLEVACVQSLHRYLANG Q9TNZ2 178 27 -
KQYLEETCVEWLRRYVEYG Q9GIP6 175 27 -
KNYLEETCVEWLRRYVEYG O46790 175 27 -
KQYLEETCVEGLRRYVEYG O46788 175 27 -
RTYLEGPCKDSLLRYLENR Q60678 183 27 -
KHYLEETCVQWLRRHVENG Q95592 175 27 -
RTYLEGPCKDSLLRYLENR Q95551 183 27 -
RTYLEGPCKDSLLRYLENR HA1U_MOUSE 183 27 -
RTYLEGPCKDSLLRYLENR Q31202 183 27 -
RTYLEGPCKDSLLRYLENR HA1T_MOUSE 183 27 -
KQYLEETCVEWLRRYVEYG Q95601 175 27 -
KHYLQNTCVEWLTKYVSYG O62881 178 28 -
RAYLQEECLEWLRRFLEKG Q9GJE3 178 27 -
KAYLEEECVQWLKKYLQMG Q9TPK7 182 28 -
KAYLEEECVQWLKKYLQMG Q9TPL0 182 28 -
KQYLEETCVEWLRRYVEYG O46791 175 27 -
KHYLEETCVQWLRRYVEHG Q9TQD4 175 27 -
RAYLEIECVEWLRKYLEKG Q9TNZ3 181 27 -
KNYLEETCVEWLRRYVEYG HA1F_CHICK 176 27 -
KNYLEETCVEWLRRYVEYG O73904 175 27 -
KNYLEETCVEWLRRYVEYG Q31400 175 27 -
KQYLEETCVEWLRRYVEYG O46789 175 27 -
RVYLEGPCMVWLFKYLTVG Q31204 188 27 -
RAYVEGECLELLHRFLRNG Q31093 181 27 -
KSYLEETCVEGLRRYVEYG O73901 175 27 -
RAYVEGECLELLHRFLRNG Q31166 181 27 -
KHYQEESCPQCLQRYVEHG Q9TQD5 175 27 -
RAYVDGECLELLHRFLQNG Q62708 181 27 -
RAYVDGECLELLHRFLQNG Q9QYV4 181 27 -
KNFLEGRCLEWLRRHLENG Q30428 187 27 -
KIYLEEECVQWLKKYLEMG Q30768 182 28 -
KNWLEEECIAWLKRFLEYG O19478 172 28 -
KAYLEGECIEWLQKYLQYG P79458 176 28 -
KNWLEEECIAWLKRFLEYG O97985 176 28 -
KNWLEEECIAWLKRFLEYG O97986 161 28 -
KNWLEEECIAWLKRFLEYG Q95460 176 28 -
KNWLEEECIAWLKRFLEYG Q9BCU2 176 28 -
KNWLEEECIAWLKRFLEYG Q9BCU3 176 28 -
KNWLEEECIAWLKRFLEYG Q9BCU4 176 28 -
KNWLEEECIAWLKRFLEYG Q9BD49 176 28 -
KNWLEEECIAWLKRFLEYG Q9BD50 176 28 -
KNWLEEECIAWLKRFLEYG Q9NPL2 176 28 -
KNWLEEECIAWLKRFLEYG Q9TQB9 172 28 -
KGYLEGICIEWLKKYLRYG O46838 170 28 -
KGYLEGICIEWLKKYLRYG O46829 170 28 -
KGYLEGICIEWLKKYLRYG O46837 170 28 -
KGYLEGICIEWLKKYLRYG O46846 170 28 -
KGYLEGICIEWLKKYLRYG O46847 170 28 -
KGYLEGICIEWLKKYLRYG O46828 170 28 -
KGYLEGICIEWLKKYLRYG O46817 170 28 -
KGYLEGICIEWLKKYLRYG O46830 170 28 -
KNYLENICIEWLQKYVGYG Q9GIW6 179 28 -
KGYLEGICIEWLKKYLRYG O46836 170 28 -
KGYLEGICIEWLKKYLRYG O46849 170 28 -
KGYLEGICIEWLKKYLRYG O46845 170 28 -
KGYLEGICIEWLKKYLRYG O46818 170 28 -
KNYLENTCIEWLKKYVNYG Q31499 175 28 -
KGYLEGICIEWLKKYLRYG O46843 170 28 -
KGYLEGICIEWLKKYLRYG O46841 170 28 -
KNYLENLCIEWLKKYMNNG Q9TP98 174 29 -
KNYLEKECIEWLQKYVGYG O62896 179 28 -
KGYLEGICIEWLKKYLRYG O46835 170 28 -
KGYLEGICIEWLKKYLRYG O46839 170 28 -
KGYLEGICIEWLKKYLRYG O46844 170 28 -
KGYLEGICIEWLKKYLRYG O46848 170 28 -
KNYLQNICIEGLKRYLSYG Q9TPA6 175 29 -
KNYLENTCIEWLKKYVNYG Q9GJB8 175 28 -
KNYLENTCIEWLKKYVNYG Q9TNX1 175 28 -
KGYLEGICIEWLKKYLRYG O46840 170 28 -
KGYLEGICIEWLKKYLRYG O46885 170 28 -
KNYLQNICIEGLKRYLSYG Q08546 175 29 -
KHELGTVCVQNLRRYLEHG Q9BCW3 175 28 -
KGYLEGICIEWLQKYLKNG Q9MX69 171 28 -
KGYLEGICIEWLKKYLRYG O46820 170 28 -
KGYLEGTCIEWLKKYLKLG O19481 175 28 -
KGYLEGICIEWLKKYLRYG O46831 170 28 -
KGYLEGICIEWLKKYLRYG O46825 170 28 -
KGYLEGICIEWLKKYLRYG O46886 170 28 -
KNYLQNLCIEWLKKYLSYG Q9TPA1 175 29 -
KGYLEGICIEWLKKYLRYG O46842 170 28 -
KGYLEGICIEWLKKYLRYG O46832 170 28 -
KGYLEGICIEWLKKYLRYG O46822 170 28 -
KNYLQNICIEWLKKYLSYG Q9TPA0 175 29 -
KGYLEGICIEWLKKYLRYG O46821 170 28 -
KGYLEGICIEWLKKYLRYG O46827 170 28 -
ENYLKNTCIEWLKKYVGYG O62894 179 28 -
ENYLKNTCIEWLKKYVGYG O62895 179 28 -
KGYLEGICIEWLKKYLRYG O46826 170 28 -
KGYLEGICIEWLKKYLRYG O46824 170 28 -
KNYLQNLCIEGLKRYLSYG Q9TPA2 175 29 -
KAYLENTCIEWLNKYVAYG O97982 170 28 -
KHYLTQECIEWLKKYLDYG Q9TNN8 176 28 -
KHYLTQTCIEWLKKYLDYG Q9GIJ3 174 28 -
KHYLTQTCIEWLKKYLDYG Q9GJB9 174 28 -
KNYLQNICIEWLKKYLSYG Q9TPA5 138 29 -
KNYLENICIEDLKKYLSYG Q9TPA4 175 29 -
KGYLEGICIEWLKKYLRYG O46823 170 28 -
KGYLEGICIEWLKKYLRYG O46819 170 28 -
KGYLEGICIEWLKKYLRYG O46834 170 28 -
KGYLEGICIEWLKKYLRYG O46833 170 28 -
KNYLQNICIEGLKRYLSYG Q9TPA3 175 29 -
TNYLENICIEWLQKYVRYG Q31387 170 28 -
KNYLENLCIEWLKKHINNG Q9TP99 174 29 -
TNYLKHECPEWLRKYVGYG O98191 180 28 -
TNYLKHECPEWLRKYVGYG O98192 180 28 -
KNYLENTCIEWLKKYVNYG Q9MX28 167 28 -
KQYLENQCIEWLRKYVGYG Q9XRX0 170 28 -
KSYLEKECILWLQRYLTLG Q62585 187 28 -
KNYLQNLCIEGLKRYLSYG Q9TPA7 175 29 -
NNYLTQTCIEWLKKYVDYG Q9TNN4 176 28 -
TNYLKHECPEWLQKYVGYG O98187 180 28 -
TNYLKHECPEWLQRHVRYG O98189 180 28 -
KTYLQGECVQRLLRYLDLG O19443 181 27 -
KNYLEEECIEWLRKYLLYG O19480 170 28 -
TNYLKHVCPEWLQRHVRYG O98188 180 28 -
KNYLEKECIEWLQKYVGYG Q9GIW7 179 28 -
KTYLEKECILWLQRYLTMG Q31129 180 28 -
TNYLKHECPEWLQRHVRYG O98193 180 28 -
EARLKDNCSELLQKYPEKE Q31277 179 19 -
KNYYTQICIEWLKKYVDYG Q31594 174 28 -
KNYYTQICIEWLKKYVDYG P79570 176 28 -
SQDLKSHCSDLLQKYLEKG Q31208 169 14 -
SQDLKSHCSDLLQKYLEKG Q31615 169 14 -
SQDLKSHCSDLLQKYLEKG Q9BCZ1 169 14 -
KNYHTKECVDWLKKYLAYG O98272 175 28 -
KNYCTQECIDWLKKYVDYG Q9GJC2 174 28 -
SQHLEGHCSDVLQKYLEKG Q31206 169 14 -
KNYFTQICPEWLKKYVNYG Q9XR30 174 28 -
KGYLENECIEWVQKYVGYG Q31365 172 28 -
NNYLTQTCIEWLKKYVDYG Q9GJC0 168 28 -
NNYLTQTCIEWLKKYVDYG Q9TNW9 168 28 -
KSYFNQICIEWLQKYVNYG Q9GJE4 177 28 -
KNYITQECIDWLKKYVDYG Q9GJC1 176 28 -
KAYLEEECPEMLKRYLNYS Q9DBB7 174 28 -
KAYLEEECPEMLKRYLNYS ZA2G_MOUSE 174 28 -
KAYLEEECPATLRKYLKYS O60386 179 28 -
KAYLEEECPATLRKYLKYS ZA2G_HUMAN 176 28 -
RAYLERDCPEQLQWLLELG Q9GL43 180 28 -
KAYLEEECPTMLKKYLTYS ZA2G_RAT 174 28 -
KSYYTQICIQWLQKYVNYG O46706 177 28 -
RDYLEKDCPEQLKRLLELG HFE_MOUSE 192 28 -
RDYLEKDCPEQLKRLLELG Q9D754 192 28 -
KSYLTTECVKWLQMYLRYQ Q9XR31 174 28 -
RAYLERDCPEQLQWLLELG Q9GKZ0 180 28 -
RAYLERDCPEQLQWLLELG Q9GL42 180 28 -
RAYLERDCPEQLQWLLELG Q9GL41 180 28 -
RAYLERDCPAQLQQLLELG HFE_HUMAN 180 28 -
RAYLERDCPAQLQQLLELG O75929 180 28 -
KRYLEQECIEWLQNFLRFS Q9TP04 178 28 -
KSFLLGACVEGLLQYLNFG O19442 181 27 -
KSYYTQICIQWLQKYVNYG O46705 177 28 -
RDYLQRDCPQQLKQVLELQ HFE_RAT 193 28 -