SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00150

Identifier
PEPCARBXLASE  [View Relations]  [View Alignment]  
Accession
PR00150
No. of Motifs
7
Creation Date
10-FEB-1994  (UPDATE 07-JUN-1999)
Title
Phosphoenolpyruvate carboxylase signature
Database References

PROSITE; PS00781 PEPCASE_1; PS00393 PEPCASE_2
PFAM; PF00311 PEPcase
INTERPRO; IPR001449
Literature References
1. SUGIMOTO, T., KAWASAKI, T., KATO, T., WHITTIER, R.F., SHIBATA, D. AND
KAWAMURA, Y.
cDNA sequence and expression of a phosphoenolpyruvate carboxylase gene from
soybean.
PLANT MOL.BIOL. 20(4) 743-747 (1992).
 
2. PATHIRANA, S.M., VANCE, C.P., MILLER, S.S. AND GANTT, J.S.
Alfalfa root nodule phosphoenolpyruvate carboxylase - Characterization of
the cDNA and expression in effective and plant-controlled ineffective 
nodules.
PLANT MOL.BIOL. 20(3) 437-450 (1992).
 
3. EIKMANNS, B.J., FOLLETTIE, M.T., GRIOT, M.U. AND SINSKEY, A.J.
The phosphoenolpyruvate carboxylase gene of Corynebacterium glutamicum - 
Molecular cloning, nucleotide sequence, and expression.
MOL.GEN.GENET. 218(2) 330-339 (1989).
 
4. HERMANS, J. AND WESTHOFF, P.
Homologous genes for the c4 isoform of phosphoenolpyruvate carboxylase in a 
c3 and a c4 Flavera species.
MOL.GEN.GENET. 234(2) 275-284 (1992).

Documentation
Phosphoenolpyruvate carboxylase (PEPCase), an enzyme found in all multi-
cellular plants, catalyses the formation of oxaloacetate from phospho-
enolpyruvate (PEP) and a hydrocarbonate ion [1]. This reaction is harnessed
by C4 plants to capture and concentrate carbon dioxide into the photo-
synthetic bundle sheath cells. It also plays a key role in the nitrogen
fixation pathway in legume root nodules: here it functions in concert with
glutamine, glutamate and asparagine synthetases and aspartate amido trans-
ferase, to synthesise aspartate and asparagine, the major nitrogen trans-
port compounds in various amine-transporting plant species [2]. PEPCase
also plays an antipleurotic role in bacteria and plant cells, supplying
oxaloacetate to the TCA cycle, which requires continuous input of C4
molecules in order to replenish the intermediates removed for amino acid
biosynthesis [3].
 
The C-terminus of the enzyme contains the active site: this includes a
conserved lysine residue, involved in substrate binding, and other conserved
residues important for the catalytic mechanism [4].
 
PEPCARBXLASE is a 7-element fingerprint that provides a signature for
phosphoenolpyruvate carboxylases. The fingerprint was derived from an
initial alignment of 5 sequences: the motifs were drawn from conserved
regions spanning virtually the full alignment length - motifs 1 and 5
include regions encoded by PROSITE patterns PEPCASE_1 (PS00781) and
PEPCASE_2 (PS00393), which contain catalytically-important His and Lys
residues respectively, and motif 6 includes a region thought to be
involved in binding phosphoenolpyruvate. Two iterations on OWL 22.1 were
required to reach convergence, at which point a true set comprising 23
sequences was identified.
 
An update on SPTR37_9f identified a true set of 39 sequences.
Summary Information
39 codes involving  7 elements
0 codes involving 6 elements
0 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
739393939393939
60000000
50000000
40000000
30000000
20000000
1234567
True Positives
CAP1_FLAPR    CAP1_FLATR    CAP1_MAIZE    CAP1_MESCR    
CAP1_SACHY CAP1_SORVU CAP1_SOYBN CAP2_FLATR
CAP2_MAIZE CAP2_MESCR CAP2_SORVU CAP2_SOYBN
CAP3_SORVU CAPP_AMAHP CAPP_ANANI CAPP_ANASP
CAPP_CORGL CAPP_ECOLI CAPP_FLAAU CAPP_HAEIN
CAPP_MEDSA CAPP_MYCLE CAPP_PEA CAPP_PICAB
CAPP_RHOOB CAPP_RHOPA CAPP_SOLTU CAPP_THESP
CAPP_TOBAC O22117 O23946 O81357
O82072 O82723 P74299 P93695
P93696 Q42634 Q43267
Sequence Titles
CAP1_FLAPR  PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - FLAVERIA PRINGLEI. 
CAP1_FLATR PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - FLAVERIA TRINERVIA.
CAP1_MAIZE PHOSPHOENOLPYRUVATE CARBOXYLASE 1 (EC 4.1.1.31) (PEPCASE) - ZEA MAYS (MAIZE).
CAP1_MESCR PHOSPHOENOLPYRUVATE CARBOXYLASE 1 (EC 4.1.1.31) (PEPCASE) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
CAP1_SACHY PHOSPHOENOLPYRUVATE CARBOXYLASE, HOUSEKEEPING ISOZYME (EC 4.1.1.31) (PEPCASE) - SACCHARUM HYBRID (SUGARCANE).
CAP1_SORVU PHOSPHOENOLPYRUVATE CARBOXYLASE 1 (EC 4.1.1.31) (PEPCASE) (CP21) - SORGHUM VULGARE (SORGHUM).
CAP1_SOYBN PHOSPHOENOLPYRUVATE CARBOXYLASE, HOUSEKEEPING ISOZYME (EC 4.1.1.31) (PEPCASE) - GLYCINE MAX (SOYBEAN).
CAP2_FLATR PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - FLAVERIA TRINERVIA.
CAP2_MAIZE PHOSPHOENOLPYRUVATE CARBOXYLASE 2 (EC 4.1.1.31) (PEPCASE) - ZEA MAYS (MAIZE).
CAP2_MESCR PHOSPHOENOLPYRUVATE CARBOXYLASE 2 (EC 4.1.1.31) (PEPCASE) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
CAP2_SORVU PHOSPHOENOLPYRUVATE CARBOXYLASE 2 (EC 4.1.1.31) (PEPCASE) (CP28) - SORGHUM VULGARE (SORGHUM).
CAP2_SOYBN PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - GLYCINE MAX (SOYBEAN).
CAP3_SORVU PHOSPHOENOLPYRUVATE CARBOXYLASE 3 (EC 4.1.1.31) (PEPCASE) (CP46) - SORGHUM VULGARE (SORGHUM).
CAPP_AMAHP PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - AMARANTHUS HYPOCHONDRIACUS (PRINCE'S FEATHER).
CAPP_ANANI PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - ANACYSTIS NIDULANS.
CAPP_ANASP PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - ANABAENA SP. (STRAIN PCC 7120).
CAPP_CORGL PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - CORYNEBACTERIUM GLUTAMICUM (BREVIBACTERIUM FLAVUM).
CAPP_ECOLI PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - ESCHERICHIA COLI.
CAPP_FLAAU PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - FLAVERIA AUSTRALASICA.
CAPP_HAEIN PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - HAEMOPHILUS INFLUENZAE.
CAPP_MEDSA PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - MEDICAGO SATIVA (ALFALFA).
CAPP_MYCLE PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - MYCOBACTERIUM LEPRAE.
CAPP_PEA PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - PISUM SATIVUM (GARDEN PEA).
CAPP_PICAB PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - PICEA ABIES (NORWAY SPRUCE) (PICEA EXCELSA).
CAPP_RHOOB PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - RHODOTHERMUS OBAMENSIS.
CAPP_RHOPA PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - RHODOPSEUDOMONAS PALUSTRIS.
CAPP_SOLTU PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - SOLANUM TUBEROSUM (POTATO).
CAPP_THESP PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) (PEPC) - THERMUS SP. (STRAIN 71).
CAPP_TOBAC PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - NICOTIANA TABACUM (COMMON TOBACCO).
O22117 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) (PEPCASE) - GLYCINE MAX (SOYBEAN).
O23946 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - GOSSYPIUM HIRSUTUM (UPLAND COTTON).
O81357 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O82072 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - TRITICUM AESTIVUM (WHEAT).
O82723 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - VICIA FABA (BROAD BEAN).
P74299 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - SYNECHOCYSTIS SP. (STRAIN PCC 6803).
P93695 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - VANILLA PLANIFOLIA (VANILLA).
P93696 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - VANILLA PLANIFOLIA (VANILLA).
Q42634 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - BRASSICA NAPUS (RAPE).
Q43267 PHOSPHOENOLPYRUVATE CARBOXYLASE (EC 4.1.1.31) - ZEA MAYS (MAIZE).
Scan History
OWL22_1    2  100  NSINGLE    
OWL26_0 1 100 NSINGLE
SPTR37_9f 2 41 NSINGLE
Initial Motifs
Motif 1  width=14
Element Seqn Id St Int Rpt
LVLTAHPTQSVRRS CAP2_FLATR 167 167 -
LVFTAHPTQSVRRS CAP1_MESCR 168 168 -
LVLTAHPTEITRRT CAPP_ECOLI 133 133 -
LVFTAHPTEIVRHT CAPP_ANANI 241 241 -
PVLTAHPTETRRRT CAPP_CORGL 132 132 -

Motif 2 width=17
Element Seqn Id St Int Rpt
FRTDEIRRTPPTPQDEM CAP2_FLATR 220 39 -
FRTDEIRRTQPTPQDEM CAP1_MESCR 221 39 -
WHTDEIRKLRPSPVDEA CAPP_ECOLI 186 39 -
WRTDELHQFKPTVLDEV CAPP_ANANI 300 45 -
WQTALIRVARPRIEDEI CAPP_CORGL 191 45 -

Motif 3 width=16
Element Seqn Id St Int Rpt
FSSWMGGDRDGNPRVT CAP2_FLATR 280 43 -
FSSWMGGDRDGNPRVT CAP1_MESCR 281 43 -
FTSWMGGDRDGNPNVT CAPP_ECOLI 245 42 -
FGSWVGSDRDGNPSVT CAPP_ANANI 359 42 -
PGSWIGGDHDGNPYVT CAPP_CORGL 249 41 -

Motif 4 width=21
Element Seqn Id St Int Rpt
FGLSLVKLDIRQESDRHTEVL CAP2_FLATR 440 144 -
FGLCLVKLDIRQESERHTDVM CAP1_MESCR 441 144 -
FGVPLVRIDIRQESTRHTEAL CAPP_ECOLI 386 125 -
FGFNLVHLDIRQESSRHSDAI CAPP_ANANI 523 148 -
FGFNLYALDLRQNSESYEDVL CAPP_CORGL 401 136 -

Motif 5 width=21
Element Seqn Id St Int Rpt
QEVMIGYSDSGKDAGRFSAAW CAP2_FLATR 589 128 -
QEVMIGYSDSGKDAGRLSAAW CAP1_MESCR 590 128 -
QMVMIGYSDSAKDAGVMAASW CAPP_ECOLI 535 128 -
QEVMLGYSDSNKDSGFLSSNW CAPP_ANANI 688 144 -
QEVMLGYSDSNKDGGYFSANW CAPP_CORGL 567 145 -

Motif 6 width=30
Element Seqn Id St Int Rpt
IFHGRGGTVGRGGGPTHLALLSQPPDTING CAP2_FLATR 631 21 -
MFHGRGGTVGRGGGPTHLAILAQPAETIGG CAP1_MESCR 632 21 -
LFHGRGGSIGRGGAPAHAALLSQPPGSLKG CAPP_ECOLI 577 21 -
IFHGRGGSVGRGGGPAYEAILAQPGRTTDG CAPP_ANANI 730 21 -
LFHGRGGTVGRGGGPSYDAILAQPRGAVQG CAPP_CORGL 609 21 -

Motif 7 width=27
Element Seqn Id St Int Rpt
IESLRAIPWIFSWTQTRFHLPVWLGFG CAP2_FLATR 763 102 -
IESLRAIPWIFAWTQTRFHLPVWLGVG CAP1_MESCR 764 102 -
VESLRAIPWIFAWTQNRLMLPAWLGAG CAPP_ECOLI 709 102 -
LGSLRAIPWVFSWTQSRFLLPSWYGVG CAPP_ANANI 864 104 -
VEDLRAIPWVLSWSQSRVMLPGWFGVG CAPP_CORGL 743 104 -
Final Motifs
Motif 1  width=14
Element Seqn Id St Int Rpt
LVLTAHPTQSVRRS CAP2_SORVU 162 162 -
LVLTAHPTQSVRRS Q42634 167 167 -
LVLTAHPTQSVRRS CAPP_SOLTU 168 168 -
LVLTAHPTQSVRRS O23946 167 167 -
LVLTAHPTQSVRRS CAP1_SOYBN 167 167 -
LVLTAHPTQSVRRS P93695 160 160 -
LVLTAHPTQSVRRS O81357 168 168 -
LVLTAHPTQSVRRS CAP2_MAIZE 169 169 -
LVFTAHPTQSVRRS CAP1_SORVU 163 163 -
LVLTAHPTQSVRRS CAP1_SACHY 167 167 -
LVLTAHPTQSIRRS CAP2_SOYBN 167 167 -
LVLTAHPTQSIRRS O22117 167 167 -
LVFTAHPTQSVRRS CAP2_MESCR 160 160 -
LVLTAHPTQSVRRS CAP2_FLATR 167 167 -
LVLTAHPTQSVRRS CAPP_FLAAU 167 167 -
LVLTAHPTQSVRRS CAPP_MEDSA 166 166 -
LVLTAHPTQSVRRS O82723 166 166 -
LVLTAHPTQSVRRS CAPP_PEA 166 166 -
LVLTAHPTQSVRRS CAPP_TOBAC 167 167 -
LVLTAHPTQSVRRS CAPP_PICAB 167 167 -
LVLTAHPTQSVRRS O82072 174 174 -
LVLTAHPTQSVRRS CAPP_AMAHP 167 167 -
LVFTAHPTQSVRRS CAP1_MESCR 168 168 -
LVLTAHPTQSVRRS CAP1_FLAPR 167 167 -
LVFTAHPTQSARRS Q43267 172 172 -
LVLTAHPTQSVRRS P93696 161 161 -
LVFTAHPTQSARRS CAP1_MAIZE 172 172 -
LVLTAHPTQSIRRS CAP1_FLATR 167 167 -
LVFTAHPTQSARRS CAP3_SORVU 162 162 -
LVLTAHPTEITRRT CAPP_ECOLI 133 133 -
LVLTAHPTETTRRS CAPP_HAEIN 133 133 -
LVFTAHPTEIVRHT CAPP_ANASP 150 150 -
LVFTAHPTEIVRHT CAPP_ANANI 241 241 -
LVITAHPTEIVRHT P74299 198 198 -
PVLTAHPTETRRRT CAPP_CORGL 132 132 -
PVITAHPTETRRRT CAPP_MYCLE 129 129 -
PVLTAHPTEVRRKS CAPP_RHOPA 159 159 -
PTVTAHPTEARRRS CAPP_RHOOB 150 150 -
LTFTAHPTETRRRT CAPP_THESP 139 139 -

Motif 2 width=17
Element Seqn Id St Int Rpt
FRTDEIRRTQPTPQDEM CAP2_SORVU 215 39 -
FRTDEIRRTPPTPQDEM Q42634 220 39 -
FRTDEIRRTPPTPQDEM CAPP_SOLTU 221 39 -
FRTDEIRRNPPTPQDEM O23946 220 39 -
FRTDEIRRTPPTPQDEM CAP1_SOYBN 220 39 -
FRTDEIRRTPPTPQDEM P93695 212 38 -
FRTDEIRRTPPTPQDEM O81357 221 39 -
FRTDEIRRTQPTPQDEM CAP2_MAIZE 222 39 -
FRTDEIRRTPPTPQDEM CAP1_SORVU 216 39 -
FRTDEIRRAPPTPQDEM CAP1_SACHY 220 39 -
FRTDEIRRTPPTPQDEM CAP2_SOYBN 220 39 -
FRTDEIRRTPPTPQDEM O22117 220 39 -
FRTDEIRRTPPTPQDEM CAP2_MESCR 213 39 -
FRTDEIRRTPPTPQDEM CAP2_FLATR 220 39 -
FRTDEIRRTPPTPQDEM CAPP_FLAAU 220 39 -
FRTDEIKRTPPTPQDEM CAPP_MEDSA 219 39 -
FRTDEIKRTPPTPQDEM O82723 219 39 -
FRTDEIKRTPPTPQDEM CAPP_PEA 219 39 -
FRTDEIRRTAPTPQDEM CAPP_TOBAC 220 39 -
FRTDEIRRTPPTPQDEM CAPP_PICAB 220 39 -
FRTDEIRRLSPTPQDHM O82072 227 39 -
FRTDEIRRVQPTPQDEM CAPP_AMAHP 220 39 -
FRTDEIRRTQPTPQDEM CAP1_MESCR 221 39 -
FRTDEIRRTPPTPQDEM CAP1_FLAPR 220 39 -
FRTDEIRRAQPTPQDEM Q43267 225 39 -
FRTDEIRRIPPTPQDEM P93696 214 39 -
FRTDEIRRAQPTPQAEM CAP1_MAIZE 225 39 -
FRTDEIRRTPPTPQDEM CAP1_FLATR 220 39 -
FRTDEIRRAQPTPQDEM CAP3_SORVU 215 39 -
WHTDEIRKLRPSPVDEA CAPP_ECOLI 186 39 -
WHTNEIRTVRPTPFDEA CAPP_HAEIN 186 39 -
WRTDELHQFKPTVLDEV CAPP_ANASP 210 46 -
WRTDELHQFKPTVLDEV CAPP_ANANI 300 45 -
WRTDELHQFKPTVLDEV P74299 259 47 -
WQTALIRVARPRIEDEI CAPP_CORGL 191 45 -
WQTALIRLARLQISDEI CAPP_MYCLE 182 39 -
WKTNLLRRTKLTVLDEV CAPP_RHOPA 212 39 -
LGTAEVREERPTVRDEV CAPP_RHOOB 203 39 -
YATEEVRKARPSVEDEI CAPP_THESP 180 27 -

Motif 3 width=16
Element Seqn Id St Int Rpt
FSSWMGGDRDGNPRVT CAP2_SORVU 275 43 -
FSSWMGGDRDGNPRVT Q42634 280 43 -
FSSWMGGDRDGNPRVT CAPP_SOLTU 281 43 -
FSSWMGGDRDGNPRVT O23946 280 43 -
FSSWMGGDRDGNPRVT CAP1_SOYBN 280 43 -
FSSWMGGDRDGNPRVT P93695 272 43 -
FSSWMGGDRDGNPRVT O81357 281 43 -
FSSWMGGDRDGNPRVT CAP2_MAIZE 282 43 -
FSSWMGGDRDGNPRVT CAP1_SORVU 276 43 -
FSSWMGGDRDGNPRVT CAP1_SACHY 280 43 -
FSSWMGGDRDGNPRVT CAP2_SOYBN 280 43 -
FSSWMGGDRDGNPRVT O22117 280 43 -
FSSWMGGDRDGNPRVT CAP2_MESCR 273 43 -
FSSWMGGDRDGNPRVT CAP2_FLATR 280 43 -
FSSWMGGDRDGNPRVT CAPP_FLAAU 280 43 -
FSSWMGGDRDGNPRVT CAPP_MEDSA 279 43 -
FSSWMGGDRDGNPRVT O82723 279 43 -
FSSWMGGDRDGNPRVT CAPP_PEA 279 43 -
FSSWMGGDRDGNPRVT CAPP_TOBAC 280 43 -
FSSWMGGDRDGNPRVT CAPP_PICAB 280 43 -
FSSWMGGDRDGNPRVT O82072 287 43 -
FSSWMGGDRDGNPRVT CAPP_AMAHP 280 43 -
FSSWMGGDRDGNPRVT CAP1_MESCR 281 43 -
FSSWMGGDRDGKHPRV CAP1_FLAPR 280 43 -
FSSWMGGDRDGNPRVT Q43267 285 43 -
FSPWMGGDRDGNPRVT P93696 274 43 -
FSSWMGGDRDGNPRVT CAP1_MAIZE 285 43 -
FSSWMGGDRDGKHPRV CAP1_FLATR 280 43 -
FCSWMGGDRDGNPRVT CAP3_SORVU 275 43 -
FTSWMGGDRDGNPNVT CAPP_ECOLI 245 42 -
ISSWMGGDRDGNPFVT CAPP_HAEIN 245 42 -
FGSWVGSDRDGNPSVT CAPP_ANASP 269 42 -
FGSWVGSDRDGNPSVT CAPP_ANANI 359 42 -
FGSWVGGDRDGNPSVT P74299 318 42 -
PGSWIGGDHDGNPYVT CAPP_CORGL 249 41 -
PGSWIGGDRDGNPNVT CAPP_MYCLE 241 42 -
MGSWIGGDRDGNPFVT CAPP_RHOPA 275 46 -
YRSWIGSDRDGNPYVT CAPP_RHOOB 261 41 -
FRSWMGGDRDGNPYVT CAPP_THESP 238 41 -

Motif 4 width=21
Element Seqn Id St Int Rpt
FGLSLVRLDIRQESDRHTDVL CAP2_SORVU 435 144 -
FGLALVKLDIRQESDRHTDVL Q42634 439 143 -
FGLSLVRLDIRQESDRHTDVL CAPP_SOLTU 441 144 -
FGLSLVRLDIRQESDRHTDVL O23946 440 144 -
FGLSLVRLDIRQESDRHTDVL CAP1_SOYBN 442 146 -
FGLALVKLDIRQESDRHTDVI P93695 432 144 -
FGLSLVRLDIRQESERHTDVL O81357 442 145 -
FGLSLVRLDIRQESDRHTDVL CAP2_MAIZE 442 144 -
FGLALVKLDIRQESDRHTDVL CAP1_SORVU 436 144 -
FGLSLVRLDIRQESDRHTDVM CAP1_SACHY 441 145 -
FGLSLVRLDIRQESDRHTDVL CAP2_SOYBN 442 146 -
FGLSLVRLDIRQESDRHTDVL O22117 442 146 -
FGLSLVRLDIRQESDRHTDVM CAP2_MESCR 433 144 -
FGLSLVKLDIRQESDRHTEVL CAP2_FLATR 440 144 -
FGLSLVKLDIRQESDRHTEVL CAPP_FLAAU 440 144 -
FGLSLVRLDIRQESDRHTDVM CAPP_MEDSA 441 146 -
FGLSLVRLDIRQESDRHTDVM O82723 441 146 -
FGLSLVRLDIRQESDRHTDVM CAPP_PEA 441 146 -
FGLSFVRLDIRQESDRHTDVL CAPP_TOBAC 440 144 -
FGLSFVKLDIRQESDRHSDVA CAPP_PICAB 440 144 -
FGLSLVKLDIRQESDRHTDAL O82072 447 144 -
FGLSLVKLDIRQESDRHTEVM CAPP_AMAHP 440 144 -
FGLCLVKLDIRQESERHTDVM CAP1_MESCR 441 144 -
FGLSLVKLDIRQESDRHTDVL CAP1_FLAPR 441 145 -
FGLSLVKLDIRQESERHTDVI Q43267 446 145 -
FGLSLVKLDIRQESERHTDVM P93696 433 143 -
FGLSLVKLDIRQESERHTDVI CAP1_MAIZE 446 145 -
FGLSLVKLDIRQESDRHTEVL CAP1_FLATR 441 145 -
FGLSLVKLDIRQESERQTDVI CAP3_SORVU 437 146 -
FGVPLVRIDIRQESTRHTEAL CAPP_ECOLI 386 125 -
FGVTLSQMDIRQESTRHTDAI CAPP_HAEIN 385 124 -
FDFNLTKLDIRQESTRHSDAL CAPP_ANASP 426 141 -
FGFNLVHLDIRQESSRHSDAI CAPP_ANANI 523 148 -
YGFNLAQLDFRQESSRHAEAI P74299 479 145 -
FGFNLYALDLRQNSESYEDVL CAPP_CORGL 401 136 -
FGFHLCGLDMRQNSDVHEEVV CAPP_MYCLE 390 133 -
FGFHLASLDMRQNSAVHERTI CAPP_RHOPA 425 134 -
FGFHLVTLDVRQHSSVHEAAV CAPP_RHOOB 413 136 -
FGLELAPLDLREESGKLLEAA CAPP_THESP 366 112 -

Motif 5 width=21
Element Seqn Id St Int Rpt
QEVMIGYSDSGKDAGRLSAAW CAP2_SORVU 584 128 -
QEVMIGYSDSGKDAGRLSAAW Q42634 588 128 -
QEVMIGYSDSGKDAGRLSAAW CAPP_SOLTU 590 128 -
QEVMIGYSDSGKDAGRLSAAW O23946 589 128 -
QEVMIGYSDSGKDAGRFSAAW CAP1_SOYBN 591 128 -
QEVMIGYSDSGKDAGRLSAAW P93695 581 128 -
QEVMIGYSDSGKDAGRLSAAW O81357 592 129 -
QEVMIGYSDSGKDAGRLSAAW CAP2_MAIZE 591 128 -
QEVMIGYSDSGKDAGRLSAAW CAP1_SORVU 585 128 -
QEVMIGYSDSGKDAGRFSAAW CAP1_SACHY 590 128 -
QEVMIGYSDSGKDAGRFSAAW CAP2_SOYBN 591 128 -
QEVMIGYSDSGKDAGRFSAAW O22117 591 128 -
QEVMIGYSDSGKDAGRLSAAW CAP2_MESCR 582 128 -
QEVMIGYSDSGKDAGRFSAAW CAP2_FLATR 589 128 -
QEVMIGYSDSGKDAGRFSAAW CAPP_FLAAU 589 128 -
QEVMIGYSDSGKDAGRFSAAW CAPP_MEDSA 590 128 -
QEVMIGYSDSGKDAGRFSAAW O82723 590 128 -
QEVMIGYSDSGKDAGRFSAAW CAPP_PEA 590 128 -
QEVMVGYSDSGKDAGRFSAAW CAPP_TOBAC 589 128 -
QEVMIGYSDSGKDAGRLSAGW CAPP_PICAB 589 128 -
QEVMIGYSDSGKDAGRLSAAW O82072 596 128 -
QEVMIGYSDSGKDAGRLSAAW CAPP_AMAHP 589 128 -
QEVMIGYSDSGKDAGRLSAAW CAP1_MESCR 590 128 -
QEVMIGYSDSGKDAGRFSAAW CAP1_FLAPR 590 128 -
QQVMVGYSDSGKDAGRLSAAW Q43267 595 128 -
QEVMIGYSDSGKDAGRTFCCL P93696 582 128 -
QQVMVGYSDSGKDAGRLSAAW CAP1_MAIZE 595 128 -
QEVMIGYSDSGKDAGRFSAAW CAP1_FLATR 590 128 -
QQVMVGYSDSGKDAGRLSAAW CAP3_SORVU 586 128 -
QMVMIGYSDSAKDAGVMAASW CAPP_ECOLI 535 128 -
QMVMIGYSDSAKDAGMMAASW CAPP_HAEIN 534 128 -
QEVMLGYSDSNKDSGFLSSNW CAPP_ANASP 617 170 -
QEVMLGYSDSNKDSGFLSSNW CAPP_ANANI 688 144 -
QEIMVGYSDSNKDSGFLSSNW P74299 669 169 -
QEVMLGYSDSNKDGGYFSANW CAPP_CORGL 567 145 -
QEVMLGYSDSNKDGGYLAANW CAPP_MYCLE 555 144 -
QEVMLGYSDSNKDGGFVTSGW CAPP_RHOPA 587 141 -
QEIMLGYSDSTKDGGYWMANW CAPP_RHOOB 584 150 -
VEVMIGYSDSNKDAGFLMANL CAPP_THESP 519 132 -

Motif 6 width=30
Element Seqn Id St Int Rpt
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG CAP2_SORVU 626 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG Q42634 630 21 -
MFHGRGGTVGRGGGPAHLAILSQPPETIHG CAPP_SOLTU 632 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG O23946 631 21 -
MFHGRGGTVGRGGGPTHLAILSQPPETIHG CAP1_SOYBN 633 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG P93695 623 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTVNG O81357 634 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG CAP2_MAIZE 633 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG CAP1_SORVU 627 21 -
MFHGRGGTVGRGGGPTHLAILSQPPETIHG CAP1_SACHY 632 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG CAP2_SOYBN 633 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG O22117 633 21 -
MFHGRGGTVGRGGGPTHLAILSQPPETVNG CAP2_MESCR 624 21 -
IFHGRGGTVGRGGGPTHLALLSQPPDTING CAP2_FLATR 631 21 -
IFHGRGGTVGRGGGPTHLALLSQPPDTING CAPP_FLAAU 631 21 -
MFHGRGGTVGRGGGPTHLAILSQPPETIHG CAPP_MEDSA 632 21 -
MFHGRGGTVGRGGGPTHLAILSQPPETIHG O82723 632 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG CAPP_PEA 632 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIQG CAPP_TOBAC 631 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTIHG CAPP_PICAB 631 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTING O82072 638 21 -
MFHGRGGTVGRGGGPTHLALLSQPPDTIHG CAPP_AMAHP 631 21 -
MFHGRGGTVGRGGGPTHLAILAQPAETIGG CAP1_MESCR 632 21 -
IFHGRGGTVGRGGGPTHLAILSQPPDTIHG CAP1_FLAPR 632 21 -
LFHGRGGTVGRGGGPTHLAILSQPPDTING Q43267 637 21 -
MFHGRGGTVGRGGGPTHLAILSQPPDTING P93696 624 21 -
LFHGRGGTVGRGGGPTHLAILSQPPDTING CAP1_MAIZE 637 21 -
IFHGRGGTVGRGGGPTHLALLSQPPDTING CAP1_FLATR 632 21 -
LFHGRGGTVGRGGGPTHLAILSQPPDTING CAP3_SORVU 628 21 -
LFHGRGGSIGRGGAPAHAALLSQPPGSLKG CAPP_ECOLI 577 21 -
LFHGRGGTIGRGGAPAHAALLSQPPRSLKN CAPP_HAEIN 576 21 -
IFHGRGGSVGRGGGPAHEAILAQPGHSING CAPP_ANASP 659 21 -
IFHGRGGSVGRGGGPAYEAILAQPGRTTDG CAPP_ANANI 730 21 -
LFHGRGGSVGRGGGPAYKAILAQPAGTVDG P74299 711 21 -
LFHGRGGTVGRGGGPSYDAILAQPRGAVQG CAPP_CORGL 609 21 -
LFHGRGGTVGRGGGPSYQAILAQPPGAVNG CAPP_MYCLE 597 21 -
LFHGRGGSVGRGGGPSYDAIVAQPGGAVNG CAPP_RHOPA 629 21 -
LFHGRGGTVGRGGGRANQAILAMPPVVHNG CAPP_RHOOB 626 21 -
FFHGRGTSTARGGGPAGRAIAGLPPKSVGH CAPP_THESP 561 21 -

Motif 7 width=27
Element Seqn Id St Int Rpt
IESLRAIPWIFAWTQTRFHLPVWLGFG CAP2_SORVU 758 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG Q42634 762 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG CAPP_SOLTU 764 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG O23946 763 102 -
IETLRAIPWIFAWTQTRFHLPVWLGFG CAP1_SOYBN 765 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG P93695 755 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG O81357 766 102 -
IDSLRAIPWIFAWTQTRFHLPVWLGFG CAP2_MAIZE 765 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG CAP1_SORVU 759 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG CAP1_SACHY 764 102 -
IETLRAIPWIFAWTQTRFHLPVWLGFG CAP2_SOYBN 765 102 -
IETLRAIPWIFAWTQTRFHLPVWLGFG O22117 765 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG CAP2_MESCR 756 102 -
IESLRAIPWIFSWTQTRFHLPVWLGFG CAP2_FLATR 763 102 -
IESLRAIPWIFSWTQTRFHLPVWLGFG CAPP_FLAAU 763 102 -
IETLRAIPWIFAWTQTRFHLPVWLGFG CAPP_MEDSA 764 102 -
IETLRAIPWIFAWTQTRFHLPVWLGFG O82723 764 102 -
IETLRAIPWIFPWTQTRFHLPVWLGFG CAPP_PEA 764 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG CAPP_TOBAC 763 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG CAPP_PICAB 763 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG O82072 770 102 -
IETLRAIPWIFSWTQTRFHLPVWLGCG CAPP_AMAHP 763 102 -
IESLRAIPWIFAWTQTRFHLPVWLGVG CAP1_MESCR 764 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG CAP1_FLAPR 764 102 -
ITTLRAIPWIFSWTQTRFHLPVWLGVG Q43267 769 102 -
IESLRAIPWIFAWTQTRFHLPVWLGFG P93696 755 101 -
ITTLRAIPWIFSWTQTRFHLPVWLGVG CAP1_MAIZE 769 102 -
IESLRAIPWIFSWTQTRFHLPVWLGFG CAP1_FLATR 764 102 -
ITTLRAIPWIFSWTQTRFHLPVWLGVG CAP3_SORVU 760 102 -
VESLRAIPWIFAWTQNRLMLPAWLGAG CAPP_ECOLI 709 102 -
VESLRAIPWIFAWMQNRLMLPAWLGAG CAPP_HAEIN 708 102 -
LSSLRAIPWVFSWTQTRFLLPSWYGVG CAPP_ANASP 793 104 -
LGSLRAIPWVFSWTQSRFLLPSWYGVG CAPP_ANANI 864 104 -
LSSLRAIPWVFSWTQTRFLLPAWYGVG P74299 845 104 -
VEDLRAIPWVLSWSQSRVMLPGWFGVG CAPP_CORGL 743 104 -
IADLRAIPWVLAWSQSRVMLPGWYGTG CAPP_MYCLE 731 104 -
IEDLRAIPWVFSWAQCRLMLPGWYGFG CAPP_RHOPA 763 104 -
FESLRAIPWVFAWTQVRYLIPGWFGIG CAPP_RHOOB 764 108 -
IRDLRAIPWVMAWTQVRLLLPGWYGLS CAPP_THESP 693 102 -