SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00142

Identifier
RECA  [View Relations]  [View Alignment]  
Accession
PR00142
No. of Motifs
6
Creation Date
15-FEB-1994  (UPDATE 28-OCT-2009)
Title
RecA protein signature
Database References

PROSITE; PS00321 RECA_1; PS50162 RECA_2; PS50163 RECA_3

PFAM; PF00154 recA
INTERPRO; IPR013765
PDB; 1AA3; 1G18; 1G19; 1MO3; 1MO4; 1MO5; 1MO6; 1N03

PDB; 1REA; 1U94
SCOP; 1AA3; 1G18; 1G19; 1MO3; 1MO4; 1MO5; 1MO6; 1N03

SCOP; 1REA; 1U94
CATH; 1AA3; 1G18; 1G19; 1MO3; 1MO4; 1MO5; 1MO6; 1N03

CATH; 1REA; 1U94
Literature References
1. SELBITSCHKA, W., ARNOLD, W., PRIEFER, U.B., ROTTSCHAFER, T., SCHMIDT, M.,
SIMON, R. AND PUHLER, A.
Characterization of recA genes and recA mutants of Rhizobium melioti and
Rhizobium leguminosarum biovar viciae.
MOL.GEN.GENET. 229(1) 86-95 (1991).
 
2. ZHAO, X.J. AND MCENTEE, K.
DNA sequence analysis of the recA genes from Proteus vulgaris, Erwinia 
carotovora, Shigella flexneri and Escherichia coli B/r.
MOL.GEN.GENET. 222(2-3) 369-376 (1990).

Documentation
The recA protein is a multifunctional enzyme that plays a role in 
homologous recombination, DNA repair and induction of the SOS response [1].
In homologous recombination, the protein functions as a DNA-dependent 
ATPase, promoting synapsis, heteroduplex formation and strand exchange
between homologous DNAs [1,2]. RecA has also been thought to act as a DNA-
dependent protease, cleaving specific regulatory proteins (including
bacteriophage repressors) to initiate the SOS response [1]: more recently, 
however, it has been considered to act as a protease cofactor that
promotes autodigestion of the lexA product and phage repressors. The
proteolytic inactivation of the lexA repressor by an activated form of recA
may cause a derepression of the 20 or so genes involved in the SOS 
response, which regulates DNA repair, induced mutagenesis, delayed cell
division and prophage induction in response to DNA damage [1]. The recA
protein is well conserved in nature, as might be expected for a protein
involved in the regulation of such fundamental cellular processes [1].
 
RECA is an 6-element fingerprint that provides a signature for the recA
proteins. The fingerprint was derived from an initial alignment of 8
sequences: the motifs span virtually the full alignment length, motif 4
including the nonapeptide encoded by PROSITE pattern RECA (PS00321). Five
iterations on SPTR57_40f were required to reach convergence, at which point
a true set comprising 46 sequences was identified. Several partial matches
were also found, most of which are recA protein fragments.
Summary Information
1310 codes involving  6 elements
33 codes involving 5 elements
9 codes involving 4 elements
41 codes involving 3 elements
21 codes involving 2 elements
Composite Feature Index
6131013101310131013101310
527323333337
4658953
3222323191818
253101365
123456
True Positives
A0KA75_BURCH  A0L826_MAGSM  A0M6E4_GRAFK  A0NP88_9RHOB  
A0XYZ7_9GAMM A0YD74_9GAMM A0Z6J8_9GAMM A0ZKA5_NODSP
A1A272_BIFAA A1AEN9_ECOK1 A1ATV2_PELPD A1AZL5_PARDP
A1BIQ4_CHLPD A1EPV0_VIBCH A1F832_VIBCH A1HUE5_9FIRM
A1KM75_MYCBP A1QV11_MYCTF A1T002_PSYIN A1TW37_ACIAC
A1V6W5_BURMS A1VUC3_POLNA A1WCY0_ACISJ A1WET8_VEREI
A1ZUC7_9SPHI A2P8I1_VIBCH A2PKZ0_VIBCH A2PUQ2_VIBCH
A2S8U6_BURM9 A2TR45_9FLAO A2TYC4_9FLAO A2UZ65_SHEPU
A2VL74_MYCTU A2VVQ7_9BURK A2W7P8_9BURK A3DEA3_CLOTH
A3EGF8_VIBCH A3ENA6_VIBCH A3EWF7_9BACT A3GQD3_VIBCH
A3HWX3_9SPHI A3ICA9_9BACI A3IPB2_9CHRO A3J3B9_9FLAO
A3JHQ1_9ALTE A3JSX3_9RHOB A3K228_9RHOB A3LE75_PSEAE
A3MH63_BURM7 A3N1E7_ACTP2 A3N690_BURP6 A3NRX4_BURP0
A3RQ47_RALSO A3SGP7_9RHOB A3SNY5_9RHOB A3T116_9RHOB
A3TMD7_9MICO A3TWS8_9RHOB A3U6B8_9FLAO A3UDY2_9RHOB
A3UV42_VIBSP A3V9G1_9RHOB A3VJG5_9RHOB A3VUD5_9PROT
A3VX42_9RHOB A3WBC0_9SPHN A3WM74_9GAMM A3WVK2_9BRAD
A3XAW9_9RHOB A3XGX2_9FLAO A3XXM0_9VIBR A3YGX8_9GAMM
A3YH37_9GAMM A3YK12_CAMJE A3YT62_CAMJE A3YUM4_9SYNE
A3Z8Y2_9SYNE A3ZD29_CAMJE A3ZFZ0_CAMJE A3ZNU6_9PLAN
A4AAD1_9GAMM A4AHJ3_9ACTN A4ANZ6_9FLAO A4BCJ0_9GAMM
A4BU37_9GAMM A4BXB3_9FLAO A4C6Y7_9GAMM A4CHW1_9FLAO
A4CSK9_SYNPV A4EC83_9ACTN A4EKT9_9RHOB A4ERJ5_9RHOB
A4GJZ1_9BACT A4IMG9_GEOTN A4J5T8_DESRM A4JHK1_BURVG
A4KK14_MYCTU A4KP48_FRATU A4N0Z4_HAEIN A4N6U0_HAEIN
A4NCS2_HAEIN A4NIB3_HAEIN A4NNY3_HAEIN A4NQP5_HAEIN
A4NW53_HAEIN A4PHN2_PHYPA A4PHN3_PHYPA A4S409_OSTLU
A4SD03_PROVI A4SZY2_POLSQ A4U369_9PROT A4UAE2_LACHE
A4VJP2_PSEU5 A4VSE7_STRSY A4VYN5_STRS2 A4XLD6_CALS8
A4XPD2_PSEMY A4XWQ4_PSEMY A4YXR0_BRASO A5CCL6_ORITB
A5D2R8_PELTS A5EMM4_BRASB A5FLA2_FLAJ1 A5FPE2_DEHSB
A5GDB6_GEOUR A5GVV5_SYNR3 A5I4H9_CLOBH A5IYZ1_MYCAP
A5JC36_BURMA A5KEY5_CAMJE A5KKH5_9FIRM A5KTF3_9BACT
A5L337_9GAMM A5LEG8_STRPN A5LTW1_STRPN A5M2X0_STRPN
A5MA70_STRPN A5MHL6_STRPN A5MPK3_STRPN A5MWD5_STRPN
A5N856_CLOK5 A5P749_9SPHN A5TR11_BURMA A5TXF8_FUSNP
A5U689_MYCTA A5V3L4_SPHWW A5VQX5_BRUO2 A5X9E4_PROAC
A5XX15_BURMA A5Z6J3_9FIRM A5ZGP0_9BACE A5ZPC8_9FIRM
A6A6C3_VIBCH A6AEW1_VIBCH A6AW11_VIBHA A6B6D9_VIBPA
A6BJF8_9FIRM A6BYJ2_YERPE A6CF28_9PLAN A6D4F1_9VIBR
A6DBB8_9PROT A6DUF6_9BACT A6E088_9RHOB A6EIR5_9SPHI
A6ELL5_9BACT A6EV17_9ALTE A6FHA2_9GAMM A6FSR2_9RHOB
A6FZ21_9DELT A6GK08_9DELT A6GU74_9BURK A6H1S7_FLAPJ
A6L2X2_BACV8 A6LBZ5_PARD8 A6NW33_9BACE A6PMM6_9BACT
A6TRJ2_ALKMQ A6VKZ3_ACTSZ A6W1Q4_MARMS A6XC70_SALET
A6XXS5_VIBCH A6ZIK1_THEAQ A7A8C4_BIFAD A7ACC2_9PORP
A7B2G7_RUMGN A7BD53_9ACTO A7CFE0_BURPI A7CVA2_9BACT
A7FVX9_CLOB1 A7GFZ2_CLOBL A7H0M6_CAMC5 A7H7H5_ANADF
A7HGT3_ANADF A7HMK5_FERNB A7IMQ9_XANP2 A7JEW1_FRATT
A7JFJ7_FRANO A7JPI1_FRANO A7JUT5_PASHA A7KJJ5_STAXY
A7M5K6_BACOV A7MYT7_VIBHB A7VAG0_BACUN A7VB17_9CLOT
A7VTT9_9CLOT A7YR40_FRATU A7ZFN0_CAMC1 A8CPQ2_9CHLR
A8DJT2_9BACT A8E9V2_BURPS A8F8W0_THELT A8GPU6_RICAH
A8GTM6_RICRS A8I670_CHLRE A8ICX1_AZOC5 A8KKV8_BURPS
A8L0T0_FRASN A8L6J1_FRASN A8LLK7_DINSH A8MFC2_ALKOO
A8PQD9_9COXI A8RC56_9FIRM A8RNZ1_9CLOT A8S787_9FIRM
A8SMT5_9FIRM A8SPJ7_9FIRM A8T9B8_9VIBR A8TPM0_9PROT
A8UIA5_9FLAO A8UQJ4_9AQUI A8VT65_9BACI A8YJ75_MICAE
A8YUB7_LACH4 A8ZKA1_ACAM1 A8ZLV5_ACAM1 A8ZP31_ACAM1
A8ZPF7_ACAM1 A8ZY66_DESOH A9D6F1_9RHIZ A9DT53_9FLAO
A9E4G3_9RHOB A9EMD9_9RHOB A9FNG9_9RHOB A9G764_SORC5
A9GC15_SORC5 A9GSY4_9RHOB A9HM16_GLUDA A9K5W0_BURMA
A9KG26_COXBN A9KLQ6_CLOPH A9M0G4_NEIM0 A9M4P2_9VIBR
A9MFY8_SALAR A9NCN5_COXBR A9W5Y7_METEP A9WQ43_RENSM
A9Z5H3_YERPE A9ZH63_COXBU A9ZXU8_YERPE B0AAJ2_9CLOT
B0BKA0_9MICC B0BQ84_ACTPJ B0BV65_RICRO B0C288_ACAM1
B0C5Y5_ACAM1 B0CCZ6_ACAM1 B0G577_9FIRM B0GB33_YERPE
B0GVR3_YERPE B0H198_YERPE B0HJM0_YERPE B0HV90_YERPE
B0JBR8_RHILT B0JV95_MICAN B0K1B8_THEPX B0K9N2_THEP3
B0MJ53_9FIRM B0MMT9_9FIRM B0MSV9_9BACT B0N0K4_9FIRM
B0ND63_EUBSP B0NNH2_BACSE B0NZS5_9CLOT B0P6Q8_9FIRM
B0QV50_HAEPR B0RGY9_CLAMS B0S1D5_FINM2 B0VJL1_9BACT
B1BG38_CLOPE B1BWW2_CLOPE B1C2D5_9FIRM B1CBR0_9FIRM
B1DLF1_9BACL B1EGX3_9ESCH B1FQP9_9BURK B1G226_9BURK
B1GYL2_UNCTG B1HFF1_BURPS B1HR36_LYSSC B1I314_DESAP
B1II35_CLOBK B1JY17_BURCC B1KWJ3_CLOBM B1LQ17_ECOSM
B1MZY7_LEUCK B1NEZ0_9DEIO B1QEE3_CLOBO B1QQ14_CLOBO
B1QSG2_CLOBU B1RAI9_CLOPE B1RIJ5_CLOPE B1RQ41_CLOPE
B1RUM9_UREPA B1RW17_UREPA B1RXB9_UREUR B1S2Q9_STRPN
B1S8G9_9BIFI B1SCW6_9STRE B1SQM1_9BACI B1T7P6_9BURK
B1VXV8_STRGG B1X512_PAUCH B1XRZ6_POLNS B1XY03_LEPCP
B1YVY9_BURA4 B1ZC93_METPB B1ZWP7_OPITP B2A3V4_NATTJ
B2C321_LEGPN B2D8D9_UREPA B2D9Z3_UREUR B2DKH8_STRPN
B2DQY6_STRPN B2DVL7_STRPN B2E1Y3_STRPN B2E6T2_STRPN
B2E872_BIFAN B2ERF9_9BACT B2GKH2_KOCRD B2H414_BURPS
B2IHX1_BEII9 B2JDB5_BURP8 B2KEX6_ELUMP B2N1H9_ECOLX
B2NFD6_UREUR B2NH97_UREUR B2NRK8_ECO57 B2P7H8_ECO57
B2PF74_ECO57 B2PTZ5_PROST B2SYF4_BURPP B2UGD9_RALPJ
B2UPW5_AKKM8 B2V7T2_SULSY B3A6T9_ECO57 B3ANH0_ECO57
B3B4W2_ECO57 B3BJ81_ECO57 B3BYJ2_ECO57 B3CCX8_9BACE
B3CT01_ORITI B3DR86_BIFLD B3DW93_METI4 B3E9Z2_GEOLS
B3ENK1_CHLPB B3ETT2_AMOA5 B3GY31_ACTP7 B3HDP6_ECOLX
B3HQ29_ECOLX B3I8V5_ECOLX B3ILR5_ECOLX B3JNC6_9BACE
B3JUW6_9DELT B3KIK6_9BACI B3PJB8_CELJU B3PM51_MYCA5
B3QI72_RHOPT B3R0F8_APPPP B3WAZ9_LACCB B3WCM1_LACCB
B3WLX1_ECOLX B3X0Z2_SHIDY B3XHH4_ECOLX B3XRC0_LACRE
B3XSE0_UREUR B3XV19_UREUR B3YID4_SALET B4A2F6_SALNE
B4ADR5_BACPU B4AS14_FRANO B4BH94_CLOTM B4BIW4_9BACI
B4RHD9_PHEZH B4S4R7_PROA2 B4SFE4_PELPB B4U5L7_HYDS0
B4UDA1_ANASK B4UGJ8_ANASK B4VLI9_9CYAN B4WEL0_9CAUL
B4WLQ8_9SYNE B4X4W3_9GAMM B5A674_9CAUD B5A778_9CAUD
B5BMD7_UREUR B5BYR3_SALET B5CBG8_SALET B5CR08_9FIRM
B5D1J8_9BACE B5G7B0_9ACTO B5HF96_STRPR B5IPP8_9CHRO
B5IXK8_9RHOB B5JPT4_9BACT B5JVA0_9GAMM B5JZH2_9RHOB
B5LMU1_9CHLA B5MKA1_SALET B5N4V4_SALET B5NBF9_SALET
B5NNK4_SALET B5PA02_SALET B5PGV9_SALET B5PUL0_SALHA
B5Q846_SALVI B5QFR3_CAMJE B5QRV4_LACRH B5QRW4_LACRH
B5S8Q7_RALSO B5SGP7_RALSO B5W6W4_SPIMA B5WK23_9BURK
B5Y8R3_COPPD B5YEC6_DICT6 B5YJG1_THEYD B5YLR6_THAPS
B5ZD74_GLUDA B6A8B5_9ENTR B6ANE8_9BACT B6AYP7_9RHOB
B6BE26_9RHOB B6BH95_9PROT B6BSI6_9RICK B6BWK4_9PROT
B6BZW2_9GAMM B6F2Z4_LIBAS B6FH76_9ENTR B6FS94_9CLOT
B6FZD0_9CLOT B6G4X5_9ACTN B6GBT7_9ACTN B6J042_COXB2
B6J6Y7_COXB1 B6JBM2_OLICO B6R0D5_9RHOB B6T788_MAIZE
B6W2A9_9BACE B6W918_9FIRM B6WDW6_9BACE B6WXJ7_9DELT
B6WZU4_9ENTR B6XAT0_9ENTR B6XTI1_9BIFI B6Y6M6_9RICK
B6YNU1_9BACT B6YQ33_AZOPC B6ZWC2_ECO57 B7A501_THEAQ
B7AIA5_9BACE B7ATW2_9BACE B7B4G1_9FIRM B7B7E3_9PORP
B7BJM4_9CLOT B7BZK5_9FIRM B7C8F6_9FIRM B7CIU0_BURPS
B7DL17_DESSA B7DS99_9BACL B7GJN3_ANOFW B7GQG8_BIFLI
B7H1V4_ACIB3 B7HDQ4_BACC4 B7I9U0_ACIB5 B7ID28_THEAB
B7ITN1_BACC2 B7J164_BORBZ B7J7A9_ACIF2 B7JZS9_CYAP8
B7KLB5_CYAP7 B7KPS7_METC4 B7LEB1_ECO55 B7LW30_ESCF3
B7M9D6_ECO8A B7MKG8_ECO45 B7N6S9_ECOLU B7NSH9_ECO7I
B7QSS1_9RHOB B7R8S2_9THEO B7REZ5_9THEM B7RH74_9RHOB
B7RWK5_9GAMM B7UHB7_ECO27 B7V8D1_PSEA8 B7VK57_VIBSL
B7X245_COMTE B7XTL8_BORGA B7XUE1_BORGA B7Y4S4_RUMHA
B7YNW3_VARPD B8AN40_ORYSI B8CJQ6_9GAMM B8CXC0_9FIRM
B8DFS9_LISMO B8DP00_DESVM B8DT97_BIFAN B8E2U1_9BACT
B8E8U2_9GAMM B8ETR1_METSI B8F639_HAEPR B8FL00_9DELT
B8G068_DESHD B8GAQ9_9CHLR B8GQV3_9GAMM B8H3I7_CAUCR
B8HG89_9MICC B8HR52_9CHRO B8I7D2_CLOCE B8IP29_METNO
B8J369_DESDE B8J6W0_9DELT B8J9N8_9DELT B8K904_VIBPA
B8KI12_9GAMM B8KSF1_9GAMM B8L292_9GAMM B8LRS8_PICSI
B8ZNU7_STRPN B8ZQT5_MYCLE B9AAC3_BORBU B9ANW3_9BACT
B9AW73_BIFBR B9B3Z8_9BURK B9BTL7_9BURK B9CCE0_9BURK
B9CKI0_9ACTN B9CVM8_STACP B9CWV3_9PAST B9D2D4_WOLRE
B9DEP2_9GAMM B9DPC5_STACA B9DW65_STRUB B9E1L6_CLOKL
B9EBH1_9STAP B9F9W5_ORYSJ B9JFS7_9RHIZ B9JX56_AGRVI
B9K7N7_THENE B9KEN1_CAMLA B9KHJ1_ANAMF B9KKJ7_RHOSH
B9KXK1_THERO B9L7U2_9PROT B9LCN0_9CHLR B9M365_9DELT
B9MHR9_9BURK B9MQY3_ANATH B9NRH1_9RHOB B9NYQ8_PROMA
B9R0H5_9RHOB B9SVD4_RICCO O50487 O52393
O52394 O67905 O85502 Q00ZP1_OSTTA
Q02AB1_SOLUE Q034K4_LACC3 Q03AQ0_LACC3 Q03EQ5_PEDPA
Q03YM4_LEUMM Q042C2_LACGA Q04T44_LEPBJ Q051G6_LEPBL
Q05QA7_9SYNE Q05ZF3_9SYNE Q07R91_RHOP5 Q08Y00_STIAU
Q09CN8_STIAU Q0AQY8_MARMM Q0AXJ0_SYNWW Q0BC68_BURCM
Q0BSC0_GRABC Q0BYM2_HYPNA Q0F3T6_9PROT Q0FAQ7_9RHOB
Q0FZI3_9RHIZ Q0VNJ9_ALCBS Q0YRU2_9CHLB Q10G85_ORYSJ
Q122H4_POLSJ Q13AC3_RHOPS Q13UH6_BURXL Q165U4_ROSDO
Q1A0V6_9CAUD Q1BTW3_BURCA Q1DCC5_MYXXD Q1DCH8_MYXXD
Q1GHA3_SILST Q1GSD4_SPHAL Q1IV37_ACIBL Q1K3C4_DESAC
Q1KMW1_NEIME Q1KMW2_NEIME Q1KMW8_NEIME Q1MP41_LAWIP
Q1MYV6_9GAMM Q1NDI6_9SPHN Q1NP94_9DELT Q1PK73_PROMA
Q1PYI7_9BACT Q1V252_9RICK Q1V5N0_VIBAL Q1VQU1_9FLAO
Q1WT13_LACS1 Q1YEB7_MOBAS Q1YR87_9GAMM Q1Z485_PHOPR
Q1ZCX1_9GAMM Q1ZN94_9VIBR Q218Q7_RHOPB Q21RF6_RHOFD
Q24W60_DESHY Q26HA5_9BACT Q28QV9_JANSC Q2B1K9_9BACI
Q2BQV7_9GAMM Q2C123_9GAMM Q2C9X3_9RHOB Q2EFY1_ANACE
Q2FHF3_STAA3 Q2FZ09_STAA8 Q2G8V4_NOVAD Q2GDN2_NEOSM
Q2GIE7_ANAPZ Q2IFM8_ANADE Q2IGM0_ANADE Q2ITM5_RHOP2
Q2JK85_SYNJB Q2JVF7_SYNJA Q2KYE8_BORA1 Q2M4U4_9MYCO
Q2M4U5_9MYCO Q2M4U6_9MYCO Q2M4U7_9MYCO Q2N9K3_ERYLH
Q2QJS7_PROAC Q2RJJ6_MOOTA Q2RLQ9_MOOTA Q2S2C8_SALRD
Q2SRU1_MYCCT Q2T0V0_BURTA Q308R5_STRAA Q3A1W3_PELCD
Q3ACX3_CARHZ Q3B668_PELLD Q3CZB3_STRAG Q3DA70_STRAG
Q3DGG0_STRAG Q3DQA1_STRAG Q3IFN0_PSEHT Q3JCL0_NITOC
Q3JVL9_BURP1 Q3JYN1_STRA1 Q3R742_XYLFA Q3RE83_XYLFA
Q3SGU3_THIDA Q3Y1B9_ENTFC Q3Z648_DEHE1 Q3ZW84_DEHSC
Q40IG8_EHRCH Q45ND1_MORCA Q47RS6_THEFY Q4A5K2_MYCS5
Q4BUQ0_CROWT Q4EGT3_LISMO Q4FMX8_PELUB Q4HE44_CAMCO
Q4HR02_CAMUP Q4IXX9_AZOVI Q4MMJ9_BACCE Q540Q2_LISIN
Q547E3_LISMO Q5IV56_PROAC Q5IV60_PROAC Q5LG39_BACFN
Q5PXP6_LISSE Q5QGG1_9MYCO Q5QJ16_MYCSM Q5QJ17_9MYCO
Q5QJ18_9MYCO Q5QJ19_9MYCO Q5QJ20_9MYCO Q5QJ21_9MYCO
Q5QJ22_9MYCO Q5QJ23_MYCPR Q5QJ24_MYCCH Q5QJ25_9MYCO
Q5QJ26_MYCAB Q5QJ27_9MYCO Q5QJ28_9MYCO Q5QJ29_MYCCH
Q5QJ30_MYCFO Q5QJ31_9MYCO Q5QJ32_9MYCO Q5QJ34_9MYCO
Q5S3P5_LISWE Q659J5_BACAM Q6KC82_LACPL Q6KCI5_9ENTE
Q6KCI6_9ENTE Q6KCI7_9ENTE Q6KCI8_9ENTE Q6KCI9_9ENTE
Q6KCJ0_9ENTE Q6KCJ1_9ENTE Q6KCJ2_9ENTE Q6KCJ4_9ENTE
Q6KCJ7_9ENTE Q6KCJ8_9ENTE Q6KCJ9_9ENTE Q6KCK1_9ENTE
Q6KCK2_LACPL Q6KCK4_9LACO Q6M9N0_PARUW Q6YI31_9ENTR
Q7P621_FUSNV Q7P9T0_RICSI Q83TZ0_CAMLA Q842H8_9BURK
Q845T1_CAMLA Q857P7_9CAUD Q8G906_LISMO Q8GF01_ZYMMO
Q8GJ70_BACME Q8GJ73_BACME Q8GJG2_BACAM Q8GNQ2_LISMO
Q8GNQ3_LISMO Q8RP56_MYCGA Q8VLF3_CAMLA Q8VLM8_HELPY
Q9F5P5_STRAG Q9KWG8_STRSU Q9LA65_PEWBP REC1_MYXXA
REC2_MYXXA RECA1_LACLA RECAM_ARATH RECA_ACEPO
RECA_ACHLA RECA_ACHLI RECA_ACIBC RECA_ACIBS
RECA_ACIBT RECA_ACIBY RECA_ACIC1 RECA_ACICA
RECA_ACICJ RECA_ACIF5 RECA_ACIFA RECA_ACTAC
RECA_AERHH RECA_AERSA RECA_AGRTU RECA_ALHEH
RECA_ALISL RECA_ALTMD RECA_AMYMD RECA_ANAMM
RECA_ANASP RECA_ANAVA RECA_AQUMA RECA_AQUPY
RECA_ARATH RECA_ARCB4 RECA_ARTAT RECA_ARTS2
RECA_AZOLI RECA_AZOSB RECA_AZOSE RECA_AZOVI
RECA_BACA2 RECA_BACAH RECA_BACAN RECA_BACC1
RECA_BACCN RECA_BACCR RECA_BACFR RECA_BACHD
RECA_BACLD RECA_BACLI RECA_BACP2 RECA_BACSK
RECA_BACSU RECA_BACTN RECA_BACWK RECA_BARBK
RECA_BARHE RECA_BARQU RECA_BART1 RECA_BAUCH
RECA_BDEBA RECA_BIFBR RECA_BIFLO RECA_BORAP
RECA_BORBR RECA_BORBU RECA_BORDL RECA_BORGA
RECA_BORHD RECA_BORHE RECA_BORPA RECA_BORPD
RECA_BORPE RECA_BRAJA RECA_BRUA1 RECA_BRUA2
RECA_BRUAB RECA_BRUC2 RECA_BRUME RECA_BRUSI
RECA_BRUSU RECA_BURCE RECA_BURCJ RECA_BURM1
RECA_BURMA RECA_BURPS RECA_BURS3 RECA_CAMFE
RECA_CAMFF RECA_CAMHC RECA_CAMJ8 RECA_CAMJD
RECA_CAMJE RECA_CAMJJ RECA_CAMJR RECA_CAMLA
RECA_CAUCR RECA_CAUSK RECA_CHLAB RECA_CHLCH
RECA_CHLCV RECA_CHLFF RECA_CHLL2 RECA_CHLMU
RECA_CHLP8 RECA_CHLPN RECA_CHLT2 RECA_CHLT3
RECA_CHLTA RECA_CHLTB RECA_CHLTR RECA_CHRSD
RECA_CHRVI RECA_CHRVO RECA_CITK8 RECA_CLAM3
RECA_CLOAB RECA_CLOB8 RECA_CLOBA RECA_CLOBB
RECA_CLOD6 RECA_CLONN RECA_CLOP1 RECA_CLOPE
RECA_CLOPS RECA_CLOTE RECA_COLP3 RECA_CORDI
RECA_COREF RECA_CORGB RECA_CORGL RECA_CORJK
RECA_CORPS RECA_CORU7 RECA_COXBU RECA_CUPTR
RECA_CYAA5 RECA_CYTH3 RECA_DECAR RECA_DEIGD
RECA_DEIRA RECA_DELAS RECA_DESDG RECA_DESPS
RECA_DESVH RECA_DESVV RECA_DICNV RECA_ECO24
RECA_ECO57 RECA_ECO5E RECA_ECOHS RECA_ECOL5
RECA_ECOL6 RECA_ECOLC RECA_ECOLI RECA_ECOSE
RECA_ECOUT RECA_EHRCJ RECA_EHRCR RECA_EHRRG
RECA_EHRRW RECA_ENT38 RECA_ENTAG RECA_ENTFA
RECA_ENTFC RECA_ENTGA RECA_ENTHR RECA_ENTMU
RECA_ENTS8 RECA_ERWCA RECA_ERWCT RECA_ERWT9
RECA_EXIS2 RECA_FRAAA RECA_FRAP2 RECA_FRASC
RECA_FRAT1 RECA_FRATF RECA_FRATH RECA_FRATM
RECA_FRATN RECA_FRATO RECA_FRATT RECA_FRATW
RECA_FUSNN RECA_GEOBB RECA_GEOMG RECA_GEOSL
RECA_GLOVI RECA_GLUOX RECA_HAEDU RECA_HAEI8
RECA_HAEIE RECA_HAEIG RECA_HAEIN RECA_HAES1
RECA_HAES2 RECA_HAHCH RECA_HALHL RECA_HELAH
RECA_HELHP RECA_HELMI RECA_HELP2 RECA_HELPG
RECA_HELPH RECA_HELPJ RECA_HELPS RECA_HELPY
RECA_HERA2 RECA_HERAR RECA_HERSE RECA_IDILO
RECA_JANMA RECA_KINRD RECA_KLEP3 RECA_KLEP7
RECA_LACAC RECA_LACBA RECA_LACDA RECA_LACDB
RECA_LACF3 RECA_LACJO RECA_LACLC RECA_LACLM
RECA_LACLS RECA_LACPE RECA_LACPL RECA_LACRD
RECA_LACRJ RECA_LACSS RECA_LEGPA RECA_LEGPC
RECA_LEGPH RECA_LEGPL RECA_LEGPN RECA_LEIXX
RECA_LEPBA RECA_LEPBP RECA_LEPIC RECA_LEPIN
RECA_LEPME RECA_LISIN RECA_LISIV RECA_LISMF
RECA_LISMO RECA_LISSE RECA_LISW6 RECA_LISWE
RECA_MAGMM RECA_MANSM RECA_MARAV RECA_MESFL
RECA_MESSB RECA_METCA RECA_METCL RECA_METFK
RECA_METFL RECA_METPP RECA_METRJ RECA_METS4
RECA_MYCA1 RECA_MYCA9 RECA_MYCBO RECA_MYCGI
RECA_MYCH2 RECA_MYCH7 RECA_MYCHJ RECA_MYCLE
RECA_MYCMM RECA_MYCMO RECA_MYCMS RECA_MYCMY
RECA_MYCPA RECA_MYCPE RECA_MYCPN RECA_MYCPU
RECA_MYCSJ RECA_MYCSK RECA_MYCSM RECA_MYCSS
RECA_MYCTU RECA_MYCUA RECA_MYCVP RECA_NEIG1
RECA_NEIG2 RECA_NEIGO RECA_NEIMA RECA_NEIMB
RECA_NEIMF RECA_NITEC RECA_NITEU RECA_NITHX
RECA_NITMU RECA_NITSB RECA_NITWN RECA_NOCFA
RECA_NOCSJ RECA_NOSP7 RECA_OCEIH RECA_OCHA4
RECA_OENOB RECA_PARDE RECA_PARL1 RECA_PASHA
RECA_PASMU RECA_PETMO RECA_PHOLL RECA_PHOPR
RECA_PORG3 RECA_PORGI RECA_PRERU RECA_PROAC
RECA_PROM0 RECA_PROM1 RECA_PROM2 RECA_PROM3
RECA_PROM4 RECA_PROM5 RECA_PROM9 RECA_PROMA
RECA_PROMH RECA_PROMI RECA_PROMM RECA_PROMP
RECA_PROMS RECA_PROMT RECA_PROVU RECA_PSE14
RECA_PSEA6 RECA_PSEA7 RECA_PSEAB RECA_PSEAE
RECA_PSEE4 RECA_PSEF5 RECA_PSEFL RECA_PSEOL
RECA_PSEP1 RECA_PSEPF RECA_PSEPG RECA_PSEPK
RECA_PSEPU RECA_PSEPW RECA_PSESM RECA_PSEST
RECA_PSETO RECA_PSEU2 RECA_PSYA2 RECA_PSYCK
RECA_PSYWF RECA_RALEH RECA_RALEJ RECA_RALEU
RECA_RALME RECA_RALSO RECA_RHIE6 RECA_RHIEC
RECA_RHIL3 RECA_RHILO RECA_RHILP RECA_RHILV
RECA_RHILW RECA_RHIME RECA_RHOBA RECA_RHOCA
RECA_RHOCS RECA_RHOPA RECA_RHORT RECA_RHOS1
RECA_RHOS5 RECA_RHOSH RECA_RHOSR RECA_RHOVI
RECA_RICB8 RECA_RICBR RECA_RICCK RECA_RICCN
RECA_RICFE RECA_RICM5 RECA_RICPR RECA_RICTY
RECA_ROSCS RECA_ROSS1 RECA_RUBXD RECA_SACD2
RECA_SACEN RECA_SALA4 RECA_SALAI RECA_SALCH
RECA_SALDC RECA_SALEP RECA_SALG2 RECA_SALHS
RECA_SALNS RECA_SALPA RECA_SALPB RECA_SALPK
RECA_SALSV RECA_SALTI RECA_SALTO RECA_SALTY
RECA_SERMA RECA_SERP5 RECA_SHEAM RECA_SHEB5
RECA_SHEB8 RECA_SHEB9 RECA_SHEDO RECA_SHEFN
RECA_SHEHH RECA_SHELP RECA_SHEON RECA_SHEPA
RECA_SHEPC RECA_SHESA RECA_SHESH RECA_SHESM
RECA_SHESR RECA_SHESW RECA_SHEWM RECA_SHIB3
RECA_SHIBS RECA_SHIDS RECA_SHIF8 RECA_SHIFL
RECA_SHISO RECA_SHISS RECA_SILPO RECA_SINMW
RECA_SODGL RECA_SODGM RECA_SPIPL RECA_STAA1
RECA_STAA2 RECA_STAA9 RECA_STAAB RECA_STAAC
RECA_STAAE RECA_STAAM RECA_STAAN RECA_STAAR
RECA_STAAS RECA_STAAT RECA_STAAU RECA_STAAW
RECA_STAEQ RECA_STAES RECA_STAHJ RECA_STAS1
RECA_STRA3 RECA_STRA5 RECA_STRAG RECA_STRAM
RECA_STRAW RECA_STREM RECA_STRGC RECA_STRLI
RECA_STRM5 RECA_STRMK RECA_STRMU RECA_STRP1
RECA_STRP2 RECA_STRP3 RECA_STRP4 RECA_STRP6
RECA_STRP8 RECA_STRP9 RECA_STRPB RECA_STRPC
RECA_STRPD RECA_STRPF RECA_STRPG RECA_STRPI
RECA_STRPM RECA_STRPN RECA_STRPS RECA_STRPZ
RECA_STRR6 RECA_STRRM RECA_STRSV RECA_STRT1
RECA_STRT2 RECA_STRTD RECA_STRTR RECA_STRVL
RECA_SULDN RECA_SULNB RECA_SYMTH RECA_SYNAS
RECA_SYNE7 RECA_SYNFM RECA_SYNP2 RECA_SYNP6
RECA_SYNPW RECA_SYNPX RECA_SYNS3 RECA_SYNS9
RECA_SYNSC RECA_SYNY3 RECA_THEAQ RECA_THEEB
RECA_THEM4 RECA_THEMA RECA_THEP1 RECA_THESQ
RECA_THET2 RECA_THET8 RECA_THETH RECA_THETN
RECA_THICR RECA_THIFE RECA_TREDE RECA_TREPA
RECA_TREPS RECA_TROW8 RECA_TROWT RECA_UREP2
RECA_UREPA RECA_UREU1 RECA_VIBAN RECA_VIBC3
RECA_VIBCH RECA_VIBF1 RECA_VIBFM RECA_VIBNA
RECA_VIBPA RECA_VIBVU RECA_VIBVY RECA_WIGBR
RECA_WOLPM RECA_WOLPP RECA_WOLSU RECA_WOLTR
RECA_XANAC RECA_XANC5 RECA_XANC8 RECA_XANCB
RECA_XANCI RECA_XANCP RECA_XANOM RECA_XANOP
RECA_XANOR RECA_XENBV RECA_XENNE RECA_XYLF2
RECA_XYLFA RECA_XYLFM RECA_XYLFT RECA_YERE8
RECA_YERP3 RECA_YERPA RECA_YERPB RECA_YERPE
RECA_YERPG RECA_YERPN RECA_YERPP RECA_YERPS
RECA_YERPY RECA_ZYMMO
True Positive Partials
Codes involving 5 elements
A0A7C2_9CAUD A2ZDM0_ORYSI A3Z2F8_9SYNE A7PE62_VITVI
A7PWL4_VITVI A7PWW1_VITVI B1N670_SOLLC B1TVE1_MICLU
B4CV92_9BACT B4F8K0_MAIZE B4FNF7_MAIZE B6TNM4_MAIZE
B7FQ63_PHATR B7YFQ5_9BACI B8A7R8_ORYSI B9HDY6_POPTR
B9RK79_RICCO B9T6M8_RICCO Q05FN0_CARRP Q0GU25_9LACT
Q3DNP3_STRAG Q3F0X4_BACTI Q4ECD9_9RICK Q53QJ3_ORYSJ
Q5N6Y9_ORYSJ Q6ASS3_ORYSJ Q7F1X7_ORYSJ Q948V7_CHLRE
RECA3_ARATH RECAM_DICDI RECA_LACLA RECA_MYCGE
RECA_TRIEI
Codes involving 4 elements
A0MN30_9CAUD A5L318_9GAMM A8MQK1_ARATH B8A939_ORYSI
B9EWE7_ORYSJ B9H9J7_POPTR Q0FH22_9RHOB Q4ETQ4_LISMO
RECA4_ARATH
Codes involving 3 elements
A2PZD0_CHLRE A4AAG4_9GAMM A5LPZ1_STRPN A5LPZ2_STRPN
A7BT78_9GAMM A7KV38_9VIRU A8L2Z2_FRASN A9D6C9_9GAMM
A9D6D2_9GAMM B0AW67_BACAN B0Q480_BACAN B0Q481_BACAN
B0QMY2_BACAN B0QMY3_BACAN B1EZA0_BACAN B1EZA1_BACAN
B1GKQ8_BACAN B1GKQ9_BACAN B1UQY9_BACAN B1UQZ0_BACAN
B2QE90_9BACL B2QE91_9BACL B3JA89_BACAN B3YTY8_BACCE
B3YTY9_BACCE B3Z5S2_BACCE B3ZMU1_BACCE B5UWT9_BACCE
B5UWU0_BACCE B5VBS3_BACCE B7HLB3_BACC7 B7HLB4_BACC7
B7JJ57_BACC0 B7JJ58_BACC0 B9IV69_BACCE B9IV70_BACCE
Q02AB2_SOLUE Q636P6_BACCZ Q636P7_BACCZ Q6HF35_BACHK
Q6HF36_BACHK
Codes involving 2 elements
A4AAD0_9GAMM A4TT30_YERPP A6M3X3_YERPE A8ASX5_BPA51
A8E2B6_BPPHE A9QY67_YERPG A9ZFL1_YERPE B0AW66_BACAN
B3JA88_BACAN B3Z5S1_BACCE B3ZMU0_BACCE B7KM99_CYAP7
B9L413_THERO O68764_YERPE Q1C030_YERPA Q1CCA9_YERPN
Q30L73_BPA51 Q4N978_THEPA Q935F3_SALTI Q94CQ8_ORYSJ
Q9RID0_YERPE
Sequence Titles
A0KA75_BURCH Protein recA - Burkholderia cenocepacia (strain HI2424). 
A0L826_MAGSM Protein recA - Magnetococcus sp. (strain MC-1).
A0M6E4_GRAFK Protein recA - Gramella forsetii (strain KT0803).
A0NP88_9RHOB Protein recA - Labrenzia aggregata IAM 12614.
A0XYZ7_9GAMM Protein recA - Alteromonadales bacterium TW-7.
A0YD74_9GAMM Protein recA - marine gamma proteobacterium HTCC2143.
A0Z6J8_9GAMM Protein recA - marine gamma proteobacterium HTCC2080.
A0ZKA5_NODSP Protein recA - Nodularia spumigena CCY 9414.
A1A272_BIFAA Protein recA - Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083).
A1AEN9_ECOK1 Protein recA - Escherichia coli O1:K1 / APEC.
A1ATV2_PELPD Protein recA - Pelobacter propionicus (strain DSM 2379).
A1AZL5_PARDP Protein recA - Paracoccus denitrificans (strain Pd 1222).
A1BIQ4_CHLPD Protein recA - Chlorobium phaeobacteroides (strain DSM 266).
A1EPV0_VIBCH Protein recA - Vibrio cholerae V52.
A1F832_VIBCH Protein recA - Vibrio cholerae 2740-80.
A1HUE5_9FIRM Protein recA - Thermosinus carboxydivorans Nor1.
A1KM75_MYCBP Protein recA - Mycobacterium bovis (strain BCG / Pasteur 1173P2).
A1QV11_MYCTF Protein recA - Mycobacterium tuberculosis (strain F11).
A1T002_PSYIN Protein recA - Psychromonas ingrahamii (strain 37).
A1TW37_ACIAC Protein recA - Acidovorax avenae subsp. citrulli (strain AAC00-1).
A1V6W5_BURMS Protein recA - Burkholderia mallei (strain SAVP1).
A1VUC3_POLNA Protein recA - Polaromonas naphthalenivorans (strain CJ2).
A1WCY0_ACISJ Protein recA - Acidovorax sp. (strain JS42).
A1WET8_VEREI Protein recA - Verminephrobacter eiseniae (strain EF01-2).
A1ZUC7_9SPHI Protein recA - Microscilla marina ATCC 23134.
A2P8I1_VIBCH Protein recA - Vibrio cholerae 1587.
A2PKZ0_VIBCH Protein recA - Vibrio cholerae MAK 757.
A2PUQ2_VIBCH Protein recA - Vibrio cholerae MZO-3.
A2S8U6_BURM9 Protein recA - Burkholderia mallei (strain NCTC 10229).
A2TR45_9FLAO Protein recA - Dokdonia donghaensis MED134.
A2TYC4_9FLAO Protein recA - Polaribacter sp. MED152.
A2UZ65_SHEPU Protein recA - Shewanella putrefaciens 200.
A2VL74_MYCTU Protein recA - Mycobacterium tuberculosis C.
A2VVQ7_9BURK Protein recA - Burkholderia cenocepacia PC184.
A2W7P8_9BURK Protein recA - Burkholderia dolosa AUO158.
A3DEA3_CLOTH Protein recA - Clostridium thermocellum (strain ATCC 27405 / DSM 1237).
A3EGF8_VIBCH Protein recA - Vibrio cholerae MO10.
A3ENA6_VIBCH Protein recA - Vibrio cholerae V51.
A3EWF7_9BACT Protein recA - Leptospirillum sp. Group II UBA.
A3GQD3_VIBCH Protein recA - Vibrio cholerae NCTC 8457.
A3HWX3_9SPHI Protein recA - Algoriphagus sp. PR1.
A3ICA9_9BACI Protein recA - Bacillus sp. B14905.
A3IPB2_9CHRO Protein recA - Cyanothece sp. CCY 0110.
A3J3B9_9FLAO Protein recA - Flavobacteria bacterium BAL38.
A3JHQ1_9ALTE Protein recA - Marinobacter sp. ELB17.
A3JSX3_9RHOB Protein recA - Rhodobacterales bacterium HTCC2150.
A3K228_9RHOB Protein recA - Sagittula stellata E-37.
A3LE75_PSEAE Protein recA - Pseudomonas aeruginosa 2192.
A3MH63_BURM7 Protein recA - Burkholderia mallei (strain NCTC 10247).
A3N1E7_ACTP2 Protein recA - Actinobacillus pleuropneumoniae serotype 5b (strain L20).
A3N690_BURP6 Protein recA - Burkholderia pseudomallei (strain 668).
A3NRX4_BURP0 Protein recA - Burkholderia pseudomallei (strain 1106a).
A3RQ47_RALSO Protein recA - Ralstonia solanacearum UW551.
A3SGP7_9RHOB Protein recA - Sulfitobacter sp. EE-36.
A3SNY5_9RHOB Protein recA - Roseovarius nubinhibens ISM.
A3T116_9RHOB Protein recA - Sulfitobacter sp. NAS-14.1.
A3TMD7_9MICO Protein recA - Janibacter sp. HTCC2649.
A3TWS8_9RHOB Protein recA - Oceanicola batsensis HTCC2597.
A3U6B8_9FLAO Protein recA - Croceibacter atlanticus HTCC2559.
A3UDY2_9RHOB Protein recA - Oceanicaulis alexandrii HTCC2633.
A3UV42_VIBSP Protein recA - Vibrio splendidus 12B01.
A3V9G1_9RHOB Protein recA - Loktanella vestfoldensis SKA53.
A3VJG5_9RHOB Protein recA - Rhodobacterales bacterium HTCC2654.
A3VUD5_9PROT Protein recA - Parvularcula bermudensis HTCC2503.
A3VX42_9RHOB Protein recA - Roseovarius sp. 217.
A3WBC0_9SPHN Protein recA - Erythrobacter sp. NAP1.
A3WM74_9GAMM Protein recA - Idiomarina baltica OS145.
A3WVK2_9BRAD Protein recA - Nitrobacter sp. Nb-311A.
A3XAW9_9RHOB Protein recA - Roseobacter sp. MED193.
A3XGX2_9FLAO Protein recA - Leeuwenhoekiella blandensis MED217.
A3XXM0_9VIBR Protein recA - Vibrio sp. MED222.
A3YGX8_9GAMM Protein recA - Marinomonas sp. MED121.
A3YH37_9GAMM Protein recA - Marinomonas sp. MED121.
A3YK12_CAMJE Protein recA - Campylobacter jejuni subsp. jejuni CF93-6.
A3YT62_CAMJE Protein recA - Campylobacter jejuni subsp. jejuni 260.94.
A3YUM4_9SYNE Protein recA - Synechococcus sp. WH 5701.
A3Z8Y2_9SYNE Protein recA - Synechococcus sp. RS9917.
A3ZD29_CAMJE Protein recA - Campylobacter jejuni subsp. jejuni HB93-13.
A3ZFZ0_CAMJE Protein recA - Campylobacter jejuni subsp. jejuni 84-25.
A3ZNU6_9PLAN Protein recA - Blastopirellula marina DSM 3645.
A4AAD1_9GAMM Protein recA - Congregibacter litoralis KT71.
A4AHJ3_9ACTN Protein recA - marine actinobacterium PHSC20C1.
A4ANZ6_9FLAO Protein recA - Flavobacteriales bacterium HTCC2170.
A4BCJ0_9GAMM Protein recA - Reinekea sp. MED297.
A4BU37_9GAMM Protein recA - Nitrococcus mobilis Nb-231.
A4BXB3_9FLAO Protein recA - Polaribacter irgensii 23-P.
A4C6Y7_9GAMM Protein recA - Pseudoalteromonas tunicata D2.
A4CHW1_9FLAO Protein recA - Robiginitalea biformata HTCC2501.
A4CSK9_SYNPV Protein recA - Synechococcus sp. (strain WH7805).
A4EC83_9ACTN Protein recA - Collinsella aerofaciens ATCC 25986.
A4EKT9_9RHOB Protein recA - Roseobacter sp. CCS2.
A4ERJ5_9RHOB Protein recA - Roseobacter sp. SK209-2-6.
A4GJZ1_9BACT Protein recA - uncultured marine bacterium EB80_69G07.
A4IMG9_GEOTN Protein recA - Geobacillus thermodenitrificans (strain NG80-2).
A4J5T8_DESRM Protein recA - Desulfotomaculum reducens (strain MI-1).
A4JHK1_BURVG Protein recA - Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808)).
A4KK14_MYCTU Protein recA - Mycobacterium tuberculosis str. Haarlem.
A4KP48_FRATU Protein recA - Francisella tularensis subsp. holarctica 257.
A4N0Z4_HAEIN Protein recA - Haemophilus influenzae 22.1-21.
A4N6U0_HAEIN Protein recA - Haemophilus influenzae R3021.
A4NCS2_HAEIN Protein recA - Haemophilus influenzae 3655.
A4NIB3_HAEIN Protein recA - Haemophilus influenzae PittAA.
A4NNY3_HAEIN Protein recA - Haemophilus influenzae PittHH.
A4NQP5_HAEIN Protein recA - Haemophilus influenzae PittII.
A4NW53_HAEIN Protein recA - Haemophilus influenzae 22.4-21.
A4PHN2_PHYPA RecA - Physcomitrella patens (Moss).
A4PHN3_PHYPA RecA - Physcomitrella patens (Moss).
A4S409_OSTLU Predicted protein - Ostreococcus lucimarinus (strain CCE9901).
A4SD03_PROVI Protein recA - Prosthecochloris vibrioformis (strain DSM 265) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 265)) (Chlorobium phaeovibrioides (strain DSM 265)).
A4SZY2_POLSQ Protein recA - Polynucleobacter sp. (strain QLW-P1DMWA-1).
A4U369_9PROT Protein recA - Magnetospirillum gryphiswaldense.
A4UAE2_LACHE Protein recA - Lactobacillus helveticus CNRZ32.
A4VJP2_PSEU5 Protein recA - Pseudomonas stutzeri (strain A1501).
A4VSE7_STRSY Protein recA - Streptococcus suis (strain 05ZYH33).
A4VYN5_STRS2 Protein recA - Streptococcus suis (strain 98HAH33).
A4XLD6_CALS8 Protein recA - Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903).
A4XPD2_PSEMY Protein recA - Pseudomonas mendocina (strain ymp).
A4XWQ4_PSEMY Protein recA - Pseudomonas mendocina (strain ymp).
A4YXR0_BRASO Protein recA - Bradyrhizobium sp. (strain ORS278).
A5CCL6_ORITB Protein recA - Orientia tsutsugamushi (strain Boryong) (Rickettsia tsutsugamushi).
A5D2R8_PELTS Protein recA - Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI).
A5EMM4_BRASB Protein recA - Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182).
A5FLA2_FLAJ1 Protein recA - Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) (Cytophaga johnsonae).
A5FPE2_DEHSB Protein recA - Dehalococcoides sp. (strain BAV1).
A5GDB6_GEOUR Protein recA - Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens).
A5GVV5_SYNR3 Protein recA - Synechococcus sp. (strain RCC307).
A5I4H9_CLOBH Protein recA - Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A).
A5IYZ1_MYCAP Protein recA - Mycoplasma agalactiae (strain PG2).
A5JC36_BURMA Protein recA - Burkholderia mallei FMH.
A5KEY5_CAMJE Protein recA - Campylobacter jejuni subsp. jejuni CG8486.
A5KKH5_9FIRM Protein recA - Ruminococcus torques ATCC 27756.
A5KTF3_9BACT Protein recA - candidate division TM7 genomosp. GTL1.
A5L337_9GAMM Protein recA - Vibrionales bacterium SWAT-3.
A5LEG8_STRPN Protein recA - Streptococcus pneumoniae SP3-BS71.
A5LTW1_STRPN Protein recA - Streptococcus pneumoniae SP9-BS68.
A5M2X0_STRPN Protein recA - Streptococcus pneumoniae SP11-BS70.
A5MA70_STRPN Protein recA - Streptococcus pneumoniae SP14-BS69.
A5MHL6_STRPN Protein recA - Streptococcus pneumoniae SP18-BS74.
A5MPK3_STRPN Protein recA - Streptococcus pneumoniae SP19-BS75.
A5MWD5_STRPN Protein recA - Streptococcus pneumoniae SP23-BS72.
A5N856_CLOK5 Protein recA - Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680).
A5P749_9SPHN Protein recA - Erythrobacter sp. SD-21.
A5TR11_BURMA Protein recA - Burkholderia mallei 2002721280.
A5TXF8_FUSNP Protein recA - Fusobacterium nucleatum subsp. polymorphum ATCC 10953.
A5U689_MYCTA Protein recA - Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra).
A5V3L4_SPHWW Protein recA - Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273).
A5VQX5_BRUO2 Protein recA - Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512).
A5X9E4_PROAC Protein recA - Propionibacterium acnes.
A5XX15_BURMA Protein recA - Burkholderia mallei JHU.
A5Z6J3_9FIRM Protein recA - Eubacterium ventriosum ATCC 27560.
A5ZGP0_9BACE Protein recA - Bacteroides caccae ATCC 43185.
A5ZPC8_9FIRM Protein recA - Ruminococcus obeum ATCC 29174.
A6A6C3_VIBCH Protein recA - Vibrio cholerae MZO-2.
A6AEW1_VIBCH Protein recA - Vibrio cholerae 623-39.
A6AW11_VIBHA Protein recA - Vibrio harveyi HY01.
A6B6D9_VIBPA Protein recA - Vibrio parahaemolyticus AQ3810.
A6BJF8_9FIRM Protein recA - Dorea longicatena DSM 13814.
A6BYJ2_YERPE Protein recA - Yersinia pestis CA88-4125.
A6CF28_9PLAN Protein recA - Planctomyces maris DSM 8797.
A6D4F1_9VIBR Protein recA - Vibrio shilonii AK1.
A6DBB8_9PROT Protein recA - Caminibacter mediatlanticus TB-2.
A6DUF6_9BACT Protein recA - Lentisphaera araneosa HTCC2155.
A6E088_9RHOB Protein recA - Roseovarius sp. TM1035.
A6EIR5_9SPHI Protein recA - Pedobacter sp. BAL39.
A6ELL5_9BACT Protein recA - unidentified eubacterium SCB49.
A6EV17_9ALTE Protein recA - Marinobacter algicola DG893.
A6FHA2_9GAMM Protein recA - Moritella sp. PE36.
A6FSR2_9RHOB Protein recA - Roseobacter sp. AzwK-3b.
A6FZ21_9DELT Protein recA - Plesiocystis pacifica SIR-1.
A6GK08_9DELT Protein recA - Plesiocystis pacifica SIR-1.
A6GU74_9BURK Protein recA - Limnobacter sp. MED105.
A6H1S7_FLAPJ Protein recA - Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511).
A6L2X2_BACV8 Protein recA - Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154).
A6LBZ5_PARD8 Protein recA - Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152).
A6NW33_9BACE Protein recA - Bacteroides capillosus ATCC 29799.
A6PMM6_9BACT Protein recA - Victivallis vadensis ATCC BAA-548.
A6TRJ2_ALKMQ Protein recA - Alkaliphilus metalliredigens (strain QYMF).
A6VKZ3_ACTSZ Protein recA - Actinobacillus succinogenes (strain ATCC 55618 / 130Z).
A6W1Q4_MARMS Protein recA - Marinomonas sp. (strain MWYL1).
A6XC70_SALET Protein recA - Salmonella enterica I.
A6XXS5_VIBCH Protein recA - Vibrio cholerae AM-19226.
A6ZIK1_THEAQ Protein recA - Thermus aquaticus.
A7A8C4_BIFAD Protein recA - Bifidobacterium adolescentis L2-32.
A7ACC2_9PORP Protein recA - Parabacteroides merdae ATCC 43184.
A7B2G7_RUMGN Protein recA - Ruminococcus gnavus ATCC 29149.
A7BD53_9ACTO Protein recA - Actinomyces odontolyticus ATCC 17982.
A7CFE0_BURPI Protein recA - Ralstonia pickettii 12D.
A7CVA2_9BACT Protein recA - Opitutaceae bacterium TAV2.
A7FVX9_CLOB1 Protein recA - Clostridium botulinum (strain ATCC 19397 / Type A).
A7GFZ2_CLOBL Protein recA - Clostridium botulinum (strain Langeland / NCTC 10281 / Type F).
A7H0M6_CAMC5 Protein recA - Campylobacter curvus (strain 525.92).
A7H7H5_ANADF Protein recA - Anaeromyxobacter sp. (strain Fw109-5).
A7HGT3_ANADF Protein recA - Anaeromyxobacter sp. (strain Fw109-5).
A7HMK5_FERNB Protein recA - Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1).
A7IMQ9_XANP2 Protein recA - Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2).
A7JEW1_FRATT Protein recA - Francisella tularensis subsp. tularensis FSC033.
A7JFJ7_FRANO Protein recA - Francisella novicida GA99-3549.
A7JPI1_FRANO Protein recA - Francisella novicida GA99-3548.
A7JUT5_PASHA Protein recA - Mannheimia haemolytica PHL213.
A7KJJ5_STAXY Protein recA - Staphylococcus xylosus.
A7M5K6_BACOV Protein recA - Bacteroides ovatus ATCC 8483.
A7MYT7_VIBHB Protein recA - Vibrio harveyi (strain ATCC BAA-1116 / BB120).
A7VAG0_BACUN Protein recA - Bacteroides uniformis ATCC 8492.
A7VB17_9CLOT Protein recA - Clostridium sp. L2-50.
A7VTT9_9CLOT Protein recA - Clostridium leptum DSM 753.
A7YR40_FRATU Protein recA - Francisella tularensis subsp. holarctica FSC022.
A7ZFN0_CAMC1 Protein recA - Campylobacter concisus (strain 13826).
A8CPQ2_9CHLR Protein recA - Dehalococcoides sp. VS.
A8DJT2_9BACT Protein recA - Candidatus Chloracidobacterium thermophilum.
A8E9V2_BURPS Protein recA - Burkholderia pseudomallei 406e.
A8F8W0_THELT Protein recA - Thermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / TMO).
A8GPU6_RICAH Protein recA - Rickettsia akari (strain Hartford).
A8GTM6_RICRS Protein recA - Rickettsia rickettsii (strain Sheila Smith).
A8I670_CHLRE Chloroplast RecA recombination protein - Chlamydomonas reinhardtii.
A8ICX1_AZOC5 Protein recA - Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571).
A8KKV8_BURPS Protein recA - Burkholderia pseudomallei Pasteur 52237.
A8L0T0_FRASN Protein recA - Frankia sp. (strain EAN1pec).
A8L6J1_FRASN Protein recA - Frankia sp. (strain EAN1pec).
A8LLK7_DINSH Protein recA - Dinoroseobacter shibae (strain DFL 12).
A8MFC2_ALKOO Protein recA - Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs)).
A8PQD9_9COXI Protein recA - Rickettsiella grylli.
A8RC56_9FIRM Protein recA - Eubacterium dolichum DSM 3991.
A8RNZ1_9CLOT Protein recA - Clostridium bolteae ATCC BAA-613.
A8S787_9FIRM Protein recA - Faecalibacterium prausnitzii M21/2.
A8SMT5_9FIRM Protein recA - Parvimonas micra ATCC 33270.
A8SPJ7_9FIRM Protein recA - Coprococcus eutactus ATCC 27759.
A8T9B8_9VIBR Protein recA - Vibrio campbellii AND4.
A8TPM0_9PROT Protein recA - alpha proteobacterium BAL199.
A8UIA5_9FLAO Protein recA - Flavobacteriales bacterium ALC-1.
A8UQJ4_9AQUI Protein recA - Hydrogenivirga sp. 128-5-R1-1.
A8VT65_9BACI Protein recA - Bacillus selenitireducens MLS10.
A8YJ75_MICAE Protein recA - Microcystis aeruginosa PCC 7806.
A8YUB7_LACH4 Protein recA - Lactobacillus helveticus (strain DPC 4571).
A8ZKA1_ACAM1 Protein recA - Acaryochloris marina (strain MBIC 11017).
A8ZLV5_ACAM1 Protein recA - Acaryochloris marina (strain MBIC 11017).
A8ZP31_ACAM1 Protein recA - Acaryochloris marina (strain MBIC 11017).
A8ZPF7_ACAM1 Protein recA - Acaryochloris marina (strain MBIC 11017).
A8ZY66_DESOH Protein recA - Desulfococcus oleovorans (strain DSM 6200 / Hxd3).
A9D6F1_9RHIZ Protein recA - Hoeflea phototrophica DFL-43.
A9DT53_9FLAO Protein recA - Kordia algicida OT-1.
A9E4G3_9RHOB Protein recA - Oceanibulbus indolifex HEL-45.
A9EMD9_9RHOB Protein recA - Phaeobacter gallaeciensis 2.10.
A9FNG9_9RHOB Protein recA - Phaeobacter gallaeciensis BS107.
A9G764_SORC5 Protein recA - Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56)).
A9GC15_SORC5 Protein recA - Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56)).
A9GSY4_9RHOB Protein recA - Roseobacter litoralis Och 149.
A9HM16_GLUDA Protein recA - Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5).
A9K5W0_BURMA Protein recA - Burkholderia mallei ATCC 10399.
A9KG26_COXBN Protein recA - Coxiella burnetii (strain Dugway 5J108-111).
A9KLQ6_CLOPH Protein recA - Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg).
A9M0G4_NEIM0 Protein recA - Neisseria meningitidis serogroup C (strain 053442).
A9M4P2_9VIBR Protein recA - Vibrio sp. 23023.
A9MFY8_SALAR Protein recA - Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980).
A9NCN5_COXBR Protein recA - Coxiella burnetii (strain RSA 331 / Henzerling II).
A9W5Y7_METEP Protein recA - Methylobacterium extorquens (strain PA1).
A9WQ43_RENSM Protein recA - Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / IFO 15589).
A9Z5H3_YERPE Protein recA - Yersinia pestis biovar Orientalis str. IP275.
A9ZH63_COXBU Protein recA - Coxiella burnetii RSA 334.
A9ZXU8_YERPE Protein recA - Yersinia pestis biovar Orientalis str. F1991016.
B0AAJ2_9CLOT Protein recA - Clostridium bartlettii DSM 16795.
B0BKA0_9MICC Protein recA - Arthrobacter phenanthrenovorans.
B0BQ84_ACTPJ Protein recA - Actinobacillus pleuropneumoniae serotype 3 (strain JL03).
B0BV65_RICRO Protein recA - Rickettsia rickettsii (strain Iowa).
B0C288_ACAM1 Protein recA - Acaryochloris marina (strain MBIC 11017).
B0C5Y5_ACAM1 Protein recA - Acaryochloris marina (strain MBIC 11017).
B0CCZ6_ACAM1 Protein recA - Acaryochloris marina (strain MBIC 11017).
B0G577_9FIRM Protein recA - Dorea formicigenerans ATCC 27755.
B0GB33_YERPE Protein recA - Yersinia pestis biovar Antiqua str. UG05-0454.
B0GVR3_YERPE Protein recA - Yersinia pestis biovar Orientalis str. MG05-1020.
B0H198_YERPE Protein recA - Yersinia pestis biovar Mediaevalis str. K1973002.
B0HJM0_YERPE Protein recA - Yersinia pestis biovar Antiqua str. B42003004.
B0HV90_YERPE Protein recA - Yersinia pestis biovar Antiqua str. E1979001.
B0JBR8_RHILT Protein recA - Rhizobium leguminosarum bv. trifolii WSM1325.
B0JV95_MICAN Protein recA - Microcystis aeruginosa (strain NIES-843).
B0K1B8_THEPX Protein recA - Thermoanaerobacter sp. (strain X514).
B0K9N2_THEP3 Protein recA - Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) (Clostridium thermohydrosulfuricum).
B0MJ53_9FIRM Protein recA - Anaerostipes caccae DSM 14662.
B0MMT9_9FIRM Protein recA - Eubacterium siraeum DSM 15702.
B0MSV9_9BACT Protein recA - Alistipes putredinis DSM 17216.
B0N0K4_9FIRM Protein recA - Clostridium ramosum DSM 1402.
B0ND63_EUBSP Protein recA - Clostridium scindens ATCC 35704.
B0NNH2_BACSE Protein recA - Bacteroides stercoris ATCC 43183.
B0NZS5_9CLOT Protein recA - Clostridium sp. SS2/1.
B0P6Q8_9FIRM Protein recA - Anaerotruncus colihominis DSM 17241.
B0QV50_HAEPR Protein recA - Haemophilus parasuis 29755.
B0RGY9_CLAMS Protein recA - Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / JCM 9667).
B0S1D5_FINM2 Protein recA - Finegoldia magna (strain ATCC 29328) (Peptostreptococcus magnus).
B0VJL1_9BACT Protein recA - Candidatus Cloacamonas acidaminovorans.
B1BG38_CLOPE Protein recA - Clostridium perfringens C str. JGS1495.
B1BWW2_CLOPE Protein recA - Clostridium perfringens E str. JGS1987.
B1C2D5_9FIRM Protein recA - Clostridium spiroforme DSM 1552.
B1CBR0_9FIRM Protein recA - Anaerofustis stercorihominis DSM 17244.
B1DLF1_9BACL Protein recA - Paenibacillus sp. JDR-2.
B1EGX3_9ESCH Protein recA - Escherichia albertii TW07627.
B1FQP9_9BURK Protein recA - Burkholderia ambifaria IOP40-10.
B1G226_9BURK Protein recA - Burkholderia graminis C4D1M.
B1GYL2_UNCTG Protein recA - Uncultured termite group 1 bacterium phylotype Rs-D17.
B1HFF1_BURPS Protein recA - Burkholderia pseudomallei S13.
B1HR36_LYSSC Protein recA - Lysinibacillus sphaericus (strain C3-41).
B1I314_DESAP Protein recA - Desulforudis audaxviator (strain MP104C).
B1II35_CLOBK Protein recA - Clostridium botulinum (strain Okra / Type B1).
B1JY17_BURCC Protein recA - Burkholderia cenocepacia (strain MC0-3).
B1KWJ3_CLOBM Protein recA - Clostridium botulinum (strain Loch Maree / Type A3).
B1LQ17_ECOSM Protein recA - Escherichia coli (strain SMS-3-5 / SECEC).
B1MZY7_LEUCK Protein recA - Leuconostoc citreum (strain KM20).
B1NEZ0_9DEIO Protein recA - Deinococcus geothermalis.
B1QEE3_CLOBO RecA protein - Clostridium botulinum NCTC 2916.
B1QQ14_CLOBO RecA protein - Clostridium botulinum Bf.
B1QSG2_CLOBU Protein RecA - Clostridium butyricum 5521.
B1RAI9_CLOPE RecA protein - Clostridium perfringens B str. ATCC 3626.
B1RIJ5_CLOPE RecA protein - Clostridium perfringens CPE str. F4969.
B1RQ41_CLOPE RecA protein - Clostridium perfringens NCTC 8239.
B1RUM9_UREPA Protein RecA - Ureaplasma parvum serovar 14 str. ATCC 33697.
B1RW17_UREPA Protein RecA - Ureaplasma parvum serovar 1 str. ATCC 27813.
B1RXB9_UREUR Protein RecA - Ureaplasma urealyticum serovar 13 str. ATCC 33698.
B1S2Q9_STRPN Protein RecA - Streptococcus pneumoniae CDC1873-00.
B1S8G9_9BIFI Putative uncharacterized protein - Bifidobacterium dentium ATCC 27678.
B1SCW6_9STRE Putative uncharacterized protein - Streptococcus infantarius subsp. infantarius ATCC BAA-102.
B1SQM1_9BACI RecA protein - Geobacillus sp. WCH70.
B1T7P6_9BURK RecA protein - Burkholderia ambifaria MEX-5.
B1VXV8_STRGG Putative RecA protein - Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350).
B1X512_PAUCH Recombinase A - Paulinella chromatophora.
B1XRZ6_POLNS RecA protein - Polynucleobacter necessarius (strain STIR1).
B1XY03_LEPCP RecA protein - Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6)).
B1YVY9_BURA4 RecA protein - Burkholderia ambifaria (strain MC40-6).
B1ZC93_METPB RecA protein - Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001).
B1ZWP7_OPITP RecA protein - Opitutus terrae (strain DSM 11246 / PB90-1).
B2A3V4_NATTJ RecA protein - Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF).
B2C321_LEGPN RecA protein - Legionella pneumophila 2300/99 Alcoy.
B2D8D9_UREPA Protein RecA - Ureaplasma parvum serovar 6 str. ATCC 27818.
B2D9Z3_UREUR Protein RecA - Ureaplasma urealyticum serovar 5 str. ATCC 27817.
B2DKH8_STRPN Protein RecA - Streptococcus pneumoniae CDC1087-00.
B2DQY6_STRPN Protein RecA - Streptococcus pneumoniae SP195.
B2DVL7_STRPN Protein RecA - Streptococcus pneumoniae CDC0288-04.
B2E1Y3_STRPN Protein RecA - Streptococcus pneumoniae CDC3059-06.
B2E6T2_STRPN Protein RecA - Streptococcus pneumoniae MLV-016.
B2E872_BIFAN Recombinase A - Bifidobacterium animalis subsp. lactis HN019.
B2ERF9_9BACT RecA protein - bacterium Ellin514.
B2GKH2_KOCRD RecA protein - Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 12708 / DC2201) (Micrococcus luteus).
B2H414_BURPS RecA protein - Burkholderia pseudomallei 1655.
B2IHX1_BEII9 RecA protein - Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712).
B2JDB5_BURP8 RecA protein - Burkholderia phymatum (strain DSM 17167 / STM815).
B2KEX6_ELUMP RecA protein - Elusimicrobium minutum (strain Pei191).
B2N1H9_ECOLX Protein RecA - Escherichia coli 53638.
B2NFD6_UREUR Protein RecA - Ureaplasma urealyticum serovar 7 str. ATCC 27819.
B2NH97_UREUR Protein RecA - Ureaplasma urealyticum serovar 11 str. ATCC 33695.
B2NRK8_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC4196.
B2P7H8_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC4113.
B2PF74_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC4076.
B2PTZ5_PROST Putative uncharacterized protein - Providencia stuartii ATCC 25827.
B2SYF4_BURPP RecA protein - Burkholderia phytofirmans (strain DSM 17436 / PsJN).
B2UGD9_RALPJ RecA protein - Ralstonia pickettii (strain 12J).
B2UPW5_AKKM8 RecA protein - Akkermansia muciniphila (strain ATCC BAA-835).
B2V7T2_SULSY RecA protein - Sulfurihydrogenibium sp. (strain YO3AOP1).
B3A6T9_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC4401.
B3ANH0_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC4486.
B3B4W2_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC4501.
B3BJ81_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC869.
B3BYJ2_ECO57 Protein RecA - Escherichia coli O157:H7 str. EC508.
B3CCX8_9BACE Putative uncharacterized protein - Bacteroides intestinalis DSM 17393.
B3CT01_ORITI RecA protein - Orientia tsutsugamushi (strain Ikeda) (Rickettsia tsutsugamushi).
B3DR86_BIFLD RecA/RadA recombinase - Bifidobacterium longum (strain DJO10A).
B3DW93_METI4 RecA/RadA recombinase - Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4)).
B3E9Z2_GEOLS RecA protein - Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ).
B3ENK1_CHLPB RecA protein - Chlorobium phaeobacteroides (strain BS1).
B3ETT2_AMOA5 Putative uncharacterized protein - Amoebophilus asiaticus (strain 5a2).
B3GY31_ACTP7 Recombinase A - Actinobacillus pleuropneumoniae serotype 7 (strain AP76).
B3HDP6_ECOLX Protein RecA - Escherichia coli B7A.
B3HQ29_ECOLX Protein RecA - Escherichia coli F11.
B3I8V5_ECOLX Protein RecA - Escherichia coli E22.
B3ILR5_ECOLX Protein RecA - Escherichia coli E110019.
B3JNC6_9BACE Putative uncharacterized protein - Bacteroides coprocola DSM 17136.
B3JUW6_9DELT RecA protein - Geobacter sp. M21.
B3KIK6_9BACI RecA protein - Geobacillus sp. Y412MC10.
B3PJB8_CELJU RecA protein - Cellvibrio japonicus (strain Ueda107).
B3PM51_MYCA5 Recombination protein RecA - Mycoplasma arthritidis (strain 158L3-1).
B3QI72_RHOPT RecA protein - Rhodopseudomonas palustris (strain TIE-1).
B3R0F8_APPPP Recombinase A - Apple proliferation phytoplasma.
B3WAZ9_LACCB Protein recA - Lactobacillus casei (strain BL23).
B3WCM1_LACCB Protein recA (Recombinase A) - Lactobacillus casei (strain BL23).
B3WLX1_ECOLX Protein RecA - Escherichia coli B171.
B3X0Z2_SHIDY Protein RecA - Shigella dysenteriae 1012.
B3XHH4_ECOLX Protein RecA - Escherichia coli 101-1.
B3XRC0_LACRE RecA protein - Lactobacillus reuteri 100-23.
B3XSE0_UREUR Protein RecA - Ureaplasma urealyticum serovar 9 str. ATCC 33175.
B3XV19_UREUR Protein RecA - Ureaplasma urealyticum serovar 12 str. ATCC 33696.
B3YID4_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188.
B4A2F6_SALNE Protein RecA - Salmonella enterica subsp. enterica serovar Newport str. SL317.
B4ADR5_BACPU Protein RecA - Bacillus pumilus ATCC 7061.
B4AS14_FRANO RecA protein - Francisella novicida FTE.
B4BH94_CLOTM RecA protein - Clostridium thermocellum DSM 4150.
B4BIW4_9BACI RecA protein - Geobacillus sp. G11MC16.
B4RHD9_PHEZH Recombinase A protein - Phenylobacterium zucineum (strain HLK1).
B4S4R7_PROA2 RecA protein - Prosthecochloris aestuarii (strain DSM 271 / SK 413).
B4SFE4_PELPB RecA protein - Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1).
B4U5L7_HYDS0 RecA protein - Hydrogenobaculum sp. (strain Y04AAS1).
B4UDA1_ANASK RecA protein - Anaeromyxobacter sp. (strain K).
B4UGJ8_ANASK RecA protein - Anaeromyxobacter sp. (strain K).
B4VLI9_9CYAN Protein RecA - Microcoleus chthonoplastes PCC 7420.
B4WEL0_9CAUL Protein RecA - Brevundimonas sp. BAL3.
B4WLQ8_9SYNE Protein RecA - Synechococcus sp. PCC 7335.
B4X4W3_9GAMM Protein RecA - Alcanivorax sp. DG881.
B5A674_9CAUD Gp114 - Mycobacterium phage Porky.
B5A778_9CAUD Gp118 - Mycobacterium phage Kostya.
B5BMD7_UREUR Protein RecA - Ureaplasma urealyticum serovar 4 str. ATCC 27816.
B5BYR3_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23.
B5CBG8_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480.
B5CR08_9FIRM Putative uncharacterized protein - Ruminococcus lactaris ATCC 29176.
B5D1J8_9BACE Putative uncharacterized protein - Bacteroides plebeius DSM 17135.
B5G7B0_9ACTO RecA - Streptomyces sp. SPB74.
B5HF96_STRPR RecA - Streptomyces pristinaespiralis ATCC 25486.
B5IPP8_9CHRO Protein RecA - Cyanobium sp. PCC 7001.
B5IXK8_9RHOB Protein RecA - Octadecabacter antarcticus 307.
B5JPT4_9BACT Protein RecA - Verrucomicrobiae bacterium DG1235.
B5JVA0_9GAMM Protein RecA - gamma proteobacterium HTCC5015.
B5JZH2_9RHOB Protein RecA - Octadecabacter antarcticus 238.
B5LMU1_9CHLA RecA - Chlamydophila pecorum E58.
B5MKA1_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29.
B5N4V4_SALET Protein RecA - Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701.
B5NBF9_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433.
B5NNK4_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191.
B5PA02_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Heidelberg str. SL486.
B5PGV9_SALET Protein RecA - Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537.
B5PUL0_SALHA Protein RecA - Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066.
B5Q846_SALVI Protein RecA - Salmonella enterica subsp. enterica serovar Virchow str. SL491.
B5QFR3_CAMJE RecA protein - Campylobacter jejuni subsp. jejuni CG8421.
B5QRV4_LACRH RecA/RadA recombinase - Lactobacillus rhamnosus HN001.
B5QRW4_LACRH RecA/RadA recombinase - Lactobacillus rhamnosus HN001.
B5S8Q7_RALSO Protein reca (Recombinase a) - Ralstonia solanacearum (Pseudomonas solanacearum).
B5SGP7_RALSO Protein reca (Recombinase a) - Ralstonia solanacearum IPO1609.
B5W6W4_SPIMA RecA protein - Arthrospira maxima CS-328.
B5WK23_9BURK RecA protein - Burkholderia sp. H160.
B5Y8R3_COPPD Protein RecA - Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT).
B5YEC6_DICT6 Protein RecA - Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12).
B5YJG1_THEYD RecA protein - Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87).
B5YLR6_THAPS Predicted protein - Thalassiosira pseudonana CCMP1335.
B5ZD74_GLUDA RecA protein - Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5).
B6A8B5_9ENTR RecA/RadA recombinase-like - Yersinia sp. MH-1.
B6ANE8_9BACT RecA protein - Leptospirillum sp. Group II '5-way CG'.
B6AYP7_9RHOB Protein RecA - Rhodobacterales bacterium HTCC2083.
B6BE26_9RHOB Protein RecA - Rhodobacterales bacterium Y4I.
B6BH95_9PROT Protein RecA - Campylobacterales bacterium GD 1.
B6BSI6_9RICK Protein RecA - Candidatus Pelagibacter sp. HTCC7211.
B6BWK4_9PROT Protein RecA - beta proteobacterium KB13.
B6BZW2_9GAMM Protein RecA - Nitrosococcus oceani AFC27.
B6F2Z4_LIBAS Recombinase A - Candidatus Liberibacter asiaticus str. psy62.
B6FH76_9ENTR Putative uncharacterized protein - Enterobacter cancerogenus ATCC 35316.
B6FS94_9CLOT Putative uncharacterized protein - Clostridium nexile DSM 1787.
B6FZD0_9CLOT Putative uncharacterized protein - Clostridium hiranonis DSM 13275.
B6G4X5_9ACTN Putative uncharacterized protein - Collinsella intestinalis DSM 13280.
B6GBT7_9ACTN Putative uncharacterized protein - Collinsella stercoris DSM 13279.
B6J042_COXB2 RecA - Coxiella burnetii (strain CbuG_Q212) (Coxiella burnetii (strain Q212)).
B6J6Y7_COXB1 RecA - Coxiella burnetii (strain CbuK_Q154) (Coxiella burnetii (strain Q154)).
B6JBM2_OLICO Protein RecA - Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5).
B6R0D5_9RHOB Protein RecA - Pseudovibrio sp. JE062.
B6T788_MAIZE Protein recA - Zea mays (Maize).
B6W2A9_9BACE Putative uncharacterized protein - Bacteroides dorei DSM 17855.
B6W918_9FIRM Putative uncharacterized protein - Anaerococcus hydrogenalis DSM 7454.
B6WDW6_9BACE Putative uncharacterized protein - Bacteroides finegoldii DSM 17565.
B6WXJ7_9DELT Putative uncharacterized protein - Desulfovibrio piger ATCC 29098.
B6WZU4_9ENTR Putative uncharacterized protein - Providencia rustigianii DSM 4541.
B6XAT0_9ENTR Putative uncharacterized protein - Providencia alcalifaciens DSM 30120.
B6XTI1_9BIFI Putative uncharacterized protein - Bifidobacterium catenulatum DSM 16992.
B6Y6M6_9RICK RecA protein - Wolbachia endosymbiont of Culex quinquefasciatus JHB.
B6YNU1_9BACT RecA protein - Thermotogales bacterium TBF 19.5.1.
B6YQ33_AZOPC Recombinase A - Azobacteroides pseudotrichonymphae genomovar. CFP2.
B6ZWC2_ECO57 Protein RecA - Escherichia coli O157:H7 str. TW14588.
B7A501_THEAQ RecA protein - Thermus aquaticus Y51MC23.
B7AIA5_9BACE Putative uncharacterized protein - Bacteroides eggerthii DSM 20697.
B7ATW2_9BACE Putative uncharacterized protein - Bacteroides pectinophilus ATCC 43243.
B7B4G1_9FIRM Putative uncharacterized protein - Mitsuokella multacida DSM 20544.
B7B7E3_9PORP Putative uncharacterized protein - Parabacteroides johnsonii DSM 18315.
B7BJM4_9CLOT Putative uncharacterized protein - Clostridium hylemonae DSM 15053.
B7BZK5_9FIRM Putative uncharacterized protein - Roseburia intestinalis L1-82.
B7C8F6_9FIRM Putative uncharacterized protein - Eubacterium biforme DSM 3989.
B7CIU0_BURPS RecA protein - Burkholderia pseudomallei 576.
B7DL17_DESSA RecA protein - Desulfovibrio salexigens DSM 2638.
B7DS99_9BACL RecA protein - Alicyclobacillus acidocaldarius LAA1.
B7GJN3_ANOFW RecA/RadA recombinase (Multifunctional SOS repair regulator) - Anoxybacillus flavithermus (strain DSM 21510 / WK1).
B7GQG8_BIFLI RecA protein - Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / NCTC 11817 / S12).
B7H1V4_ACIB3 Protein RecA - Acinetobacter baumannii (strain AB307-0294).
B7HDQ4_BACC4 Protein RecA - Bacillus cereus (strain B4264).
B7I9U0_ACIB5 DNA strand exchange and recombination protein RecA - Acinetobacter baumannii (strain AB0057).
B7ID28_THEAB Protein RecA - Thermosipho africanus (strain TCF52B).
B7ITN1_BACC2 Protein RecA - Bacillus cereus (strain G9842).
B7J164_BORBZ Protein RecA - Borrelia burgdorferi (strain ZS7).
B7J7A9_ACIF2 RecA protein - Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270)).
B7JZS9_CYAP8 RecA protein - Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1)).
B7KLB5_CYAP7 RecA protein - Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)).
B7KPS7_METC4 RecA protein - Methylobacterium chloromethanicum (strain CM4 / NCIMB 13688).
B7LEB1_ECO55 DNA strand exchange and recombination protein with protease and nuclease activity - Escherichia coli (strain 55989 / EAEC).
B7LW30_ESCF3 DNA strand exchange and recombination protein with protease and nuclease activity - Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73).
B7M9D6_ECO8A DNA strand exchange and recombination protein with protease and nuclease activity - Escherichia coli O8 (strain IAI1).
B7MKG8_ECO45 DNA strand exchange and recombination protein with protease and nuclease activity - Escherichia coli O45:K1 (strain S88 / ExPEC).
B7N6S9_ECOLU DNA strand exchange and recombination protein with protease and nuclease activity - Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC).
B7NSH9_ECO7I DNA strand exchange and recombination protein with protease and nuclease activity - Escherichia coli O7:K1 (strain IAI39 / ExPEC).
B7QSS1_9RHOB Protein RecA - Ruegeria sp. R11.
B7R8S2_9THEO Protein RecA - Carboxydibrachium pacificum DSM 12653.
B7REZ5_9THEM Protein RecA - Marinitoga piezophila KA3.
B7RH74_9RHOB Protein RecA - Roseobacter sp. GAI101.
B7RWK5_9GAMM Protein RecA - marine gamma proteobacterium HTCC2148.
B7UHB7_ECO27 DNA strand exchange and recombination protein with protease and nuclease activity - Escherichia coli O127:H6 str. E2348/69.
B7V8D1_PSEA8 RecA protein - Pseudomonas aeruginosa (strain LESB58).
B7VK57_VIBSL Protein recA (Recombinase A) - Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32)).
B7X245_COMTE RecA protein - Comamonas testosteroni KF-1.
B7XTL8_BORGA Protein RecA - Borrelia garinii PBr.
B7XUE1_BORGA Protein RecA - Borrelia garinii Far04.
B7Y4S4_RUMHA Putative uncharacterized protein - Blautia hansenii DSM 20583.
B7YNW3_VARPD RecA protein - Variovorax paradoxus S110.
B8AN40_ORYSI Putative uncharacterized protein - Oryza sativa subsp. indica (Rice).
B8CJQ6_9GAMM RecA bacterial DNA recombination protein - Shewanella piezotolerans WP3.
B8CXC0_9FIRM RecA protein - Halothermothrix orenii H 168.
B8DFS9_LISMO Protein RecA - Listeria monocytogenes HCC23.
B8DP00_DESVM RecA protein - Desulfovibrio vulgaris (strain Miyazaki).
B8DT97_BIFAN Protein RecA - Bifidobacterium animalis subsp. lactis AD011.
B8E2U1_9BACT RecA protein - Dictyoglomus turgidum DSM 6724.
B8E8U2_9GAMM RecA protein - Shewanella baltica OS223.
B8ETR1_METSI RecA protein - Methylocella silvestris BL2.
B8F639_HAEPR Recombinase A - Haemophilus parasuis SH0165.
B8FL00_9DELT RecA protein - Desulfatibacillum alkenivorans AK-01.
B8G068_DESHD RecA protein - Desulfitobacterium hafniense (strain DCB-2).
B8GAQ9_9CHLR RecA protein - Chloroflexus aggregans DSM 9485.
B8GQV3_9GAMM RecA protein - Thioalkalivibrio sp. HL-EbGR7.
B8H3I7_CAUCR RecA protein - Caulobacter crescentus NA1000.
B8HG89_9MICC RecA protein - Arthrobacter chlorophenolicus A6.
B8HR52_9CHRO RecA protein - Cyanothece sp. PCC 7425.
B8I7D2_CLOCE RecA protein - Clostridium cellulolyticum H10.
B8IP29_METNO RecA protein - Methylobacterium nodulans ORS 2060.
B8J369_DESDE RecA protein - Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774.
B8J6W0_9DELT RecA protein - Anaeromyxobacter dehalogenans 2CP-1.
B8J9N8_9DELT RecA protein - Anaeromyxobacter dehalogenans 2CP-1.
B8K904_VIBPA Protein RecA - Vibrio parahaemolyticus 16.
B8KI12_9GAMM Protein RecA - gamma proteobacterium NOR5-3.
B8KSF1_9GAMM Protein RecA - gamma proteobacterium NOR51-B.
B8L292_9GAMM Protein RecA - Stenotrophomonas sp. SKA14.
B8LRS8_PICSI Putative uncharacterized protein - Picea sitchensis (Sitka spruce).
B8ZNU7_STRPN RecA recombinase (Recombinase A) - Streptococcus pneumoniae ATCC 700669.
B8ZQT5_MYCLE RecA protein - Mycobacterium leprae Br4923.
B9AAC3_BORBU Protein RecA - Borrelia burgdorferi 72a.
B9ANW3_9BACT Putative uncharacterized protein - Prevotella copri DSM 18205.
B9AW73_BIFBR Putative uncharacterized protein - Bifidobacterium breve DSM 20213.
B9B3Z8_9BURK RecA protein - Burkholderia multivorans CGD1.
B9BTL7_9BURK RecA protein - Burkholderia multivorans CGD2.
B9CCE0_9BURK RecA protein - Burkholderia multivorans CGD2M.
B9CKI0_9ACTN Protein RecA - Atopobium rimae ATCC 49626.
B9CVM8_STACP Protein RecA - Staphylococcus capitis SK14.
B9CWV3_9PAST Recombinase A - Actinobacillus minor 202.
B9D2D4_WOLRE Protein RecA - Campylobacter rectus RM3267.
B9DEP2_9GAMM RecA protein - Tolumonas auensis DSM 9187.
B9DPC5_STACA RecA protein (Recombinase A) - Staphylococcus carnosus subsp. carnosus TM300.
B9DW65_STRUB RecA recombinase (Recombinase A) - Streptococcus uberis 0140J.
B9E1L6_CLOKL Putative uncharacterized protein - Clostridium kluyveri NBRC 12016.
B9EBH1_9STAP Recombinase RecA - Macrococcus caseolyticus JCSC5402.
B9F9W5_ORYSJ Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice).
B9JFS7_9RHIZ Recombinase A protein - Agrobacterium radiobacter K84.
B9JX56_AGRVI RecA protein - Agrobacterium vitis S4.
B9K7N7_THENE Protein recA - Thermotoga neapolitana DSM 4359.
B9KEN1_CAMLA Recombinase A - Campylobacter lari RM2100.
B9KHJ1_ANAMF RecA protein (RecA) - Anaplasma marginale (strain Florida).
B9KKJ7_RHOSH Protein recA - Rhodobacter sphaeroides KD131.
B9KXK1_THERO RecA protein - Thermomicrobium roseum DSM 5159.
B9L7U2_9PROT Protein RecA - Nautilia profundicola AmH.
B9LCN0_9CHLR RecA protein - Chloroflexus sp. Y-400-fl.
B9M365_9DELT RecA protein - Geobacter sp. FRC-32.
B9MHR9_9BURK RecA protein - Diaphorobacter sp. TPSY.
B9MQY3_ANATH RecA protein - Anaerocellum thermophilum DSM 6725.
B9NRH1_9RHOB Protein RecA - Rhodobacteraceae bacterium KLH11.
B9NYQ8_PROMA Protein RecA - Prochlorococcus marinus str. MIT 9202.
B9R0H5_9RHOB Protein RecA - Labrenzia alexandrii DFL-11.
B9SVD4_RICCO DNA repair protein reca, putative - Ricinus communis (Castor bean).
O50487 RECA PROTEIN - STREPTOMYCES COELICOLOR.
O52393 RECA PROTEIN - CHLOROBIUM TEPIDUM.
O52394 RECA PROTEIN - CHLOROFLEXUS AURANTIACUS.
O67905 RECOMBINATION PROTEIN RECA - AQUIFEX AEOLICUS.
O85502 RECA PROTEIN - STREPTOCOCCUS PARASANGUIS.
Q00ZP1_OSTTA Recombination protein (ISS) - Ostreococcus tauri.
Q02AB1_SOLUE Protein recA - Solibacter usitatus (strain Ellin6076).
Q034K4_LACC3 Protein recA - Lactobacillus casei (strain ATCC 334).
Q03AQ0_LACC3 Protein recA - Lactobacillus casei (strain ATCC 334).
Q03EQ5_PEDPA Protein recA - Pediococcus pentosaceus (strain ATCC 25745 / 183-1w).
Q03YM4_LEUMM Protein recA - Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523).
Q042C2_LACGA Protein recA - Lactobacillus gasseri (strain ATCC 33323 / DSM 20243).
Q04T44_LEPBJ Protein recA - Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197).
Q051G6_LEPBL Protein recA - Leptospira borgpetersenii serovar Hardjo-bovis (strain L550).
Q05QA7_9SYNE Protein recA - Synechococcus sp. RS9916.
Q05ZF3_9SYNE Protein recA - Synechococcus sp. BL107.
Q07R91_RHOP5 Protein recA - Rhodopseudomonas palustris (strain BisA53).
Q08Y00_STIAU Protein recA - Stigmatella aurantiaca DW4/3-1.
Q09CN8_STIAU Protein recA - Stigmatella aurantiaca DW4/3-1.
Q0AQY8_MARMM Protein recA - Maricaulis maris (strain MCS10).
Q0AXJ0_SYNWW Protein recA - Syntrophomonas wolfei subsp. wolfei (strain Goettingen).
Q0BC68_BURCM Protein recA - Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)).
Q0BSC0_GRABC Protein recA - Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1).
Q0BYM2_HYPNA Protein recA - Hyphomonas neptunium (strain ATCC 15444).
Q0F3T6_9PROT Protein recA - Mariprofundus ferrooxydans PV-1.
Q0FAQ7_9RHOB Protein recA - Rhodobacterales bacterium HTCC2255.
Q0FZI3_9RHIZ Protein recA - Fulvimarina pelagi HTCC2506.
Q0VNJ9_ALCBS Protein recA - Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573).
Q0YRU2_9CHLB Protein recA - Chlorobium ferrooxidans DSM 13031.
Q10G85_ORYSJ Os03g0639700 protein - Oryza sativa subsp. japonica (Rice).
Q122H4_POLSJ Protein recA - Polaromonas sp. (strain JS666 / ATCC BAA-500).
Q13AC3_RHOPS Protein recA - Rhodopseudomonas palustris (strain BisB5).
Q13UH6_BURXL Protein recA - Burkholderia xenovorans (strain LB400).
Q165U4_ROSDO Protein recA - Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans).
Q1A0V6_9CAUD Gp117 - Mycobacterium phage 244.
Q1BTW3_BURCA Protein recA - Burkholderia cenocepacia (strain AU 1054).
Q1DCC5_MYXXD Protein recA - Myxococcus xanthus (strain DK 1622).
Q1DCH8_MYXXD Protein recA - Myxococcus xanthus (strain DK 1622).
Q1GHA3_SILST Protein recA - Silicibacter sp. (strain TM1040).
Q1GSD4_SPHAL Protein recA - Sphingopyxis alaskensis (Sphingomonas alaskensis).
Q1IV37_ACIBL Protein recA - Acidobacteria bacterium (strain Ellin345).
Q1K3C4_DESAC Protein recA - Desulfuromonas acetoxidans DSM 684.
Q1KMW1_NEIME Protein recA - Neisseria meningitidis.
Q1KMW2_NEIME Protein recA - Neisseria meningitidis.
Q1KMW8_NEIME Protein recA - Neisseria meningitidis.
Q1MP41_LAWIP Protein recA - Lawsonia intracellularis (strain PHE/MN1-00).
Q1MYV6_9GAMM Protein recA - Bermanella marisrubri.
Q1NDI6_9SPHN Protein recA - Sphingomonas sp. SKA58.
Q1NP94_9DELT Protein recA - delta proteobacterium MLMS-1.
Q1PK73_PROMA Protein recA - uncultured Prochlorococcus marinus clone HF10-11H11.
Q1PYI7_9BACT Protein recA - Candidatus Kuenenia stuttgartiensis.
Q1V252_9RICK Protein recA - Candidatus Pelagibacter ubique HTCC1002.
Q1V5N0_VIBAL Protein recA - Vibrio alginolyticus 12G01.
Q1VQU1_9FLAO Protein recA - Psychroflexus torquis ATCC 700755.
Q1WT13_LACS1 Protein recA - Lactobacillus salivarius subsp. salivarius (strain UCC118).
Q1YEB7_MOBAS Protein recA - Manganese-oxidizing bacterium (strain SI85-9A1).
Q1YR87_9GAMM Protein recA - gamma proteobacterium HTCC2207.
Q1Z485_PHOPR Protein recA - Photobacterium profundum 3TCK.
Q1ZCX1_9GAMM Protein recA - Psychromonas sp. CNPT3.
Q1ZN94_9VIBR Protein recA - Vibrio angustum S14.
Q218Q7_RHOPB Protein recA - Rhodopseudomonas palustris (strain BisB18).
Q21RF6_RHOFD Protein recA - Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118).
Q24W60_DESHY Protein recA - Desulfitobacterium hafniense (strain Y51).
Q26HA5_9BACT Protein recA - Flavobacteria bacterium BBFL7.
Q28QV9_JANSC Protein recA - Jannaschia sp. (strain CCS1).
Q2B1K9_9BACI Protein recA - Bacillus sp. NRRL B-14911.
Q2BQV7_9GAMM Protein recA - Neptuniibacter caesariensis.
Q2C123_9GAMM Protein recA - Photobacterium sp. SKA34.
Q2C9X3_9RHOB Protein recA - Oceanicola granulosus HTCC2516.
Q2EFY1_ANACE Protein recA - Anaplasma centrale.
Q2FHF3_STAA3 Protein recA - Staphylococcus aureus (strain USA300).
Q2FZ09_STAA8 Protein recA - Staphylococcus aureus (strain NCTC 8325).
Q2G8V4_NOVAD Protein recA - Novosphingobium aromaticivorans (strain DSM 12444).
Q2GDN2_NEOSM Protein recA - Neorickettsia sennetsu (strain Miyayama).
Q2GIE7_ANAPZ Protein recA - Anaplasma phagocytophilum (strain HZ).
Q2IFM8_ANADE Protein recA - Anaeromyxobacter dehalogenans (strain 2CP-C).
Q2IGM0_ANADE Protein recA - Anaeromyxobacter dehalogenans (strain 2CP-C).
Q2ITM5_RHOP2 Protein recA - Rhodopseudomonas palustris (strain HaA2).
Q2JK85_SYNJB Protein recA - Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime).
Q2JVF7_SYNJA Protein recA - Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime).
Q2KYE8_BORA1 Protein recA - Bordetella avium (strain 197N).
Q2M4U4_9MYCO Protein recA - Mycobacterium conceptionense.
Q2M4U5_9MYCO Protein recA - Mycobacterium aubagnense.
Q2M4U6_9MYCO Protein recA - Mycobacterium phocaicum.
Q2M4U7_9MYCO Protein recA - Mycobacterium bolletii.
Q2N9K3_ERYLH Protein recA - Erythrobacter litoralis (strain HTCC2594).
Q2QJS7_PROAC Protein recA - Propionibacterium acnes.
Q2RJJ6_MOOTA Protein recA - Moorella thermoacetica (strain ATCC 39073).
Q2RLQ9_MOOTA Protein recA - Moorella thermoacetica (strain ATCC 39073).
Q2S2C8_SALRD Protein recA - Salinibacter ruber (strain DSM 13855).
Q2SRU1_MYCCT Protein recA - Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154).
Q2T0V0_BURTA Protein recA - Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301).
Q308R5_STRAA Protein recA - Streptomyces argillaceus.
Q3A1W3_PELCD Protein recA - Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1).
Q3ACX3_CARHZ Protein recA - Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008).
Q3B668_PELLD Protein recA - Pelodictyon luteolum (strain DSM 273) (Chlorobium luteolum (strain DSM 273)).
Q3CZB3_STRAG Protein recA - Streptococcus agalactiae H36B.
Q3DA70_STRAG Protein recA - Streptococcus agalactiae COH1.
Q3DGG0_STRAG Protein recA - Streptococcus agalactiae CJB111.
Q3DQA1_STRAG Protein recA - Streptococcus agalactiae 18RS21.
Q3IFN0_PSEHT Protein recA - Pseudoalteromonas haloplanktis (strain TAC 125).
Q3JCL0_NITOC Protein recA - Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848).
Q3JVL9_BURP1 Protein recA - Burkholderia pseudomallei (strain 1710b).
Q3JYN1_STRA1 Protein recA - Streptococcus agalactiae serotype Ia.
Q3R742_XYLFA Protein recA - Xylella fastidiosa Ann-1.
Q3RE83_XYLFA Protein recA - Xylella fastidiosa Dixon.
Q3SGU3_THIDA Protein recA - Thiobacillus denitrificans (strain ATCC 25259).
Q3Y1B9_ENTFC Protein recA - Enterococcus faecium DO.
Q3Z648_DEHE1 Protein recA - Dehalococcoides ethenogenes (strain 195).
Q3ZW84_DEHSC Protein recA - Dehalococcoides sp. (strain CBDB1).
Q40IG8_EHRCH Protein recA - Ehrlichia chaffeensis str. Sapulpa.
Q45ND1_MORCA Protein recA - Moraxella catarrhalis.
Q47RS6_THEFY Protein recA - Thermobifida fusca (strain YX).
Q4A5K2_MYCS5 Protein recA - Mycoplasma synoviae (strain 53).
Q4BUQ0_CROWT Protein recA - Crocosphaera watsonii.
Q4EGT3_LISMO Protein recA - Listeria monocytogenes str. 4b H7858.
Q4FMX8_PELUB Protein recA - Pelagibacter ubique.
Q4HE44_CAMCO Protein recA - Campylobacter coli RM2228.
Q4HR02_CAMUP Protein recA - Campylobacter upsaliensis RM3195.
Q4IXX9_AZOVI Protein recA - Azotobacter vinelandii DJ.
Q4MMJ9_BACCE Protein recA - Bacillus cereus G9241.
Q540Q2_LISIN Protein recA - Listeria innocua.
Q547E3_LISMO Protein recA - Listeria monocytogenes.
Q5IV56_PROAC Protein recA - Propionibacterium acnes.
Q5IV60_PROAC Protein recA - Propionibacterium acnes.
Q5LG39_BACFN Protein recA - Bacteroides fragilis (strain ATCC 25285 / NCTC 9343).
Q5PXP6_LISSE Protein recA - Listeria seeligeri.
Q5QGG1_9MYCO Protein recA - Mycobacterium massiliense.
Q5QJ16_MYCSM Protein recA - Mycobacterium smegmatis.
Q5QJ17_9MYCO Protein recA - Mycobacterium wolinskyi.
Q5QJ18_9MYCO Protein recA - Mycobacterium neworleansense.
Q5QJ19_9MYCO Protein recA - Mycobacterium porcinum.
Q5QJ20_9MYCO Protein recA - Mycobacterium mucogenicum.
Q5QJ21_9MYCO Protein recA - Mycobacterium mucogenicum.
Q5QJ22_9MYCO Protein recA - Mycobacterium septicum.
Q5QJ23_MYCPR Protein recA - Mycobacterium peregrinum.
Q5QJ24_MYCCH Protein recA - Mycobacterium chelonae.
Q5QJ25_9MYCO Protein recA - Mycobacterium immunogenum.
Q5QJ26_MYCAB Protein recA - Mycobacterium abscessus.
Q5QJ27_9MYCO Protein recA - Mycobacterium senegalense.
Q5QJ28_9MYCO Protein recA - Mycobacterium goodii.
Q5QJ29_MYCCH Protein recA - Mycobacterium chelonae.
Q5QJ30_MYCFO Protein recA - Mycobacterium fortuitum.
Q5QJ31_9MYCO Protein recA - Mycobacterium mageritense.
Q5QJ32_9MYCO Protein recA - Mycobacterium farcinogenes.
Q5QJ34_9MYCO Protein recA - Mycobacterium houstonense.
Q5S3P5_LISWE Protein recA - Listeria welshimeri.
Q659J5_BACAM Protein recA - Bacillus amyloliquefaciens.
Q6KC82_LACPL Protein recA - Lactobacillus plantarum subsp. argentoratensis.
Q6KCI5_9ENTE Protein recA - Enterococcus villorum.
Q6KCI6_9ENTE Protein recA - Enterococcus sulfureus.
Q6KCI7_9ENTE Protein recA - Tetragenococcus solitarius.
Q6KCI8_9ENTE Protein recA - Enterococcus saccharolyticus.
Q6KCI9_9ENTE Protein recA - Enterococcus ratti.
Q6KCJ0_9ENTE Protein recA - Enterococcus raffinosus.
Q6KCJ1_9ENTE Protein recA - Enterococcus pseudoavium.
Q6KCJ2_9ENTE Protein recA - Enterococcus pallens.
Q6KCJ4_9ENTE Protein recA - Enterococcus malodoratus.
Q6KCJ7_9ENTE Protein recA - Enterococcus durans.
Q6KCJ8_9ENTE Protein recA - Enterococcus columbae.
Q6KCJ9_9ENTE Protein recA - Enterococcus cecorum.
Q6KCK1_9ENTE Protein recA - Enterococcus avium.
Q6KCK2_LACPL Protein recA - Lactobacillus plantarum subsp. plantarum.
Q6KCK4_9LACO Protein recA - Lactobacillus paraplantarum.
Q6M9N0_PARUW Protein recA - Protochlamydia amoebophila (strain UWE25).
Q6YI31_9ENTR Protein recA - primary endosymbiont of Sitophilus oryzae.
Q7P621_FUSNV Protein recA - Fusobacterium nucleatum subsp. vincentii ATCC 49256.
Q7P9T0_RICSI Protein recA - Rickettsia sibirica 246.
Q83TZ0_CAMLA Protein recA - Campylobacter lari.
Q842H8_9BURK Protein recA - Burkholderia fungorum.
Q845T1_CAMLA Protein recA - Campylobacter lari.
Q857P7_9CAUD Gp117 - Mycobacterium phage Cjw1.
Q8G906_LISMO Protein recA - Listeria monocytogenes.
Q8GF01_ZYMMO Protein recA - Zymomonas mobilis subsp. mobilis.
Q8GJ70_BACME Protein recA - Bacillus megaterium.
Q8GJ73_BACME Protein recA - Bacillus megaterium.
Q8GJG2_BACAM Protein recA - Bacillus amyloliquefaciens.
Q8GNQ2_LISMO Protein recA - Listeria monocytogenes.
Q8GNQ3_LISMO Protein recA - Listeria monocytogenes.
Q8RP56_MYCGA Protein recA - Mycoplasma gallisepticum.
Q8VLF3_CAMLA Protein recA - Campylobacter lari.
Q8VLM8_HELPY Protein recA - Helicobacter pylori (Campylobacter pylori).
Q9F5P5_STRAG Protein recA - Streptococcus agalactiae.
Q9KWG8_STRSU Protein recA - Streptococcus suis.
Q9LA65_PEWBP Protein recA - Peanut witches'-broom phytoplasma.
REC1_MYXXA RECA PROTEIN 1 - MYXOCOCCUS XANTHUS.
REC2_MYXXA RECA PROTEIN 2 - MYXOCOCCUS XANTHUS.
RECA1_LACLA Protein recA, chromosomal - Lactococcus lactis subsp. lactis (Streptococcus lactis).
RECAM_ARATH DNA repair protein recA homolog 2, mitochondrial - Arabidopsis thaliana (Mouse-ear cress).
RECA_ACEPO Protein recA - Acetobacter polyoxogenes.
RECA_ACHLA Protein recA - Acholeplasma laidlawii.
RECA_ACHLI Protein recA - Acholeplasma laidlawii (strain PG-8A).
RECA_ACIBC Protein recA - Acinetobacter baumannii (strain ACICU).
RECA_ACIBS Protein recA - Acinetobacter baumannii (strain SDF).
RECA_ACIBT Protein recA - Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755).
RECA_ACIBY Protein recA - Acinetobacter baumannii (strain AYE).
RECA_ACIC1 Protein recA - Acidothermus cellulolyticus (strain ATCC 43068 / 11B).
RECA_ACICA RECA PROTEIN - ACINETOBACTER CALCOACETICUS.
RECA_ACICJ Protein recA - Acidiphilium cryptum (strain JF-5).
RECA_ACIF5 Protein recA - Acidithiobacillus ferrooxidans (strain ATCC 53993) (Leptospirillum ferrooxidans (ATCC 53993)).
RECA_ACIFA Protein recA - Acidiphilium facilis.
RECA_ACTAC Protein recA - Actinobacillus actinomycetemcomitans (Haemophilus actinomycetemcomitans).
RECA_AERHH Protein recA - Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240).
RECA_AERSA RECA PROTEIN - AEROMONAS SALMONICIDA.
RECA_AGRTU RECA PROTEIN - AGROBACTERIUM TUMEFACIENS.
RECA_ALHEH Protein recA - Alkalilimnicola ehrlichei (strain MLHE-1).
RECA_ALISL Protein recA - Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238)).
RECA_ALTMD Protein recA - Alteromonas macleodii (strain DSM 17117 / Deep ecotype).
RECA_AMYMD Protein recA - Amycolatopsis mediterranei (Nocardia mediterranei).
RECA_ANAMM Protein recA - Anaplasma marginale (strain St. Maries).
RECA_ANASP Protein recA - Anabaena sp. (strain PCC 7120).
RECA_ANAVA RECA PROTEIN - ANABAENA VARIABILIS.
RECA_AQUMA RECA PROTEIN - MAGNETOSPIRILLUM MAGNETOTACTICUM (AQUASPIRILLUM MAGNETOTACTICUM).
RECA_AQUPY Protein recA - Aquifex pyrophilus.
RECA_ARATH DNA REPAIR PROTEIN RECA PRECURSOR - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
RECA_ARCB4 Protein recA - Arcobacter butzleri (strain RM4018).
RECA_ARTAT Protein recA - Arthrobacter aurescens (strain TC1).
RECA_ARTS2 Protein recA - Arthrobacter sp. (strain FB24).
RECA_AZOLI Protein recA - Azospirillum lipoferum.
RECA_AZOSB Protein recA - Azoarcus sp. (strain BH72).
RECA_AZOSE Protein recA - Azoarcus sp. (strain EbN1) (Aromatoleum aromaticum (strain EbN1)).
RECA_AZOVI Protein recA - Azotobacter vinelandii.
RECA_BACA2 Protein recA - Bacillus amyloliquefaciens (strain FZB42).
RECA_BACAH Protein recA - Bacillus thuringiensis (strain Al Hakam).
RECA_BACAN Protein recA - Bacillus anthracis.
RECA_BACC1 Protein recA - Bacillus cereus (strain ATCC 10987).
RECA_BACCN Protein recA - Bacillus cereus subsp. cytotoxis (strain NVH 391-98).
RECA_BACCR Protein recA - Bacillus cereus (strain ATCC 14579 / DSM 31).
RECA_BACFR Protein recA - Bacteroides fragilis.
RECA_BACHD Protein recA - Bacillus halodurans.
RECA_BACLD Protein recA - Bacillus licheniformis (strain DSM 13 / ATCC 14580).
RECA_BACLI Protein recA - Bacillus licheniformis.
RECA_BACP2 Protein recA - Bacillus pumilus (strain SAFR-032).
RECA_BACSK Protein recA - Bacillus clausii (strain KSM-K16).
RECA_BACSU Protein recA - Bacillus subtilis.
RECA_BACTN Protein recA - Bacteroides thetaiotaomicron.
RECA_BACWK Protein recA - Bacillus weihenstephanensis (strain KBAB4).
RECA_BARBK Protein recA - Bartonella bacilliformis (strain ATCC 35685 / KC583).
RECA_BARHE Protein recA - Bartonella henselae (Rochalimaea henselae).
RECA_BARQU Protein recA - Bartonella quintana (Rochalimaea quintana).
RECA_BART1 Protein recA - Bartonella tribocorum (strain CIP 105476 / IBS 506).
RECA_BAUCH Protein recA - Baumannia cicadellinicola subsp. Homalodisca coagulata.
RECA_BDEBA Protein recA - Bdellovibrio bacteriovorus.
RECA_BIFBR Protein recA - Bifidobacterium breve.
RECA_BIFLO Protein recA - Bifidobacterium longum.
RECA_BORAP Protein recA - Borrelia afzelii (strain PKo).
RECA_BORBR Protein recA - Bordetella bronchiseptica (Alcaligenes bronchisepticus).
RECA_BORBU Protein recA - Borrelia burgdorferi (Lyme disease spirochete).
RECA_BORDL Protein recA - Borrelia duttonii (strain Ly).
RECA_BORGA Protein recA - Borrelia garinii.
RECA_BORHD Protein recA - Borrelia hermsii (strain DAH).
RECA_BORHE Protein recA - Borrelia hermsii.
RECA_BORPA Protein recA - Bordetella parapertussis.
RECA_BORPD Protein recA - Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448).
RECA_BORPE Protein recA - Bordetella pertussis.
RECA_BRAJA Protein recA - Bradyrhizobium japonicum.
RECA_BRUA1 Protein recA - Brucella abortus (strain S19).
RECA_BRUA2 Protein recA - Brucella abortus (strain 2308).
RECA_BRUAB Protein recA - Brucella abortus.
RECA_BRUC2 Protein recA - Brucella canis (strain ATCC 23365 / NCTC 10854).
RECA_BRUME Protein recA - Brucella melitensis.
RECA_BRUSI Protein recA - Brucella suis (strain ATCC 23445 / NCTC 10510).
RECA_BRUSU Protein recA - Brucella suis.
RECA_BURCE Protein recA - Burkholderia cepacia (Pseudomonas cepacia).
RECA_BURCJ Protein recA - Burkholderia cepacia (strain J2315 / LMG 16656) (Burkholderia cenocepacia (strain J2315)).
RECA_BURM1 Protein recA - Burkholderia multivorans (strain ATCC 17616 / 249).
RECA_BURMA Protein recA - Burkholderia mallei (Pseudomonas mallei).
RECA_BURPS Protein recA - Burkholderia pseudomallei (Pseudomonas pseudomallei).
RECA_BURS3 Protein recA - Burkholderia sp. (strain 383) (Burkholderia cepacia (strain ATCC 17760 / NCIB 9086 / R18194)).
RECA_CAMFE Protein recA - Campylobacter fetus.
RECA_CAMFF Protein recA - Campylobacter fetus subsp. fetus (strain 82-40).
RECA_CAMHC Protein recA - Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A).
RECA_CAMJ8 Protein recA - Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828).
RECA_CAMJD Protein recA - Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97).
RECA_CAMJE Protein recA - Campylobacter jejuni.
RECA_CAMJJ Protein recA - Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176).
RECA_CAMJR Protein recA - Campylobacter jejuni (strain RM1221).
RECA_CAMLA Protein recA - Campylobacter lari.
RECA_CAUCR Protein recA - Caulobacter crescentus (Caulobacter vibrioides).
RECA_CAUSK Protein recA - Caulobacter sp. (strain K31).
RECA_CHLAB Protein recA - Chlamydophila abortus.
RECA_CHLCH Protein recA - Chlorobium chlorochromatii (strain CaD3).
RECA_CHLCV Protein recA - Chlamydophila caviae.
RECA_CHLFF Protein recA - Chlamydophila felis (strain Fe/C-56).
RECA_CHLL2 Protein recA - Chlorobium limicola (strain DSM 245 / NBRC 103803).
RECA_CHLMU Protein recA - Chlamydia muridarum.
RECA_CHLP8 Protein recA - Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327)).
RECA_CHLPN Protein recA - Chlamydia pneumoniae (Chlamydophila pneumoniae).
RECA_CHLT2 Protein recA - Chlamydia trachomatis (strain L2/434/Bu / ATCC VR902B).
RECA_CHLT3 Protein recA - Chloroherpeton thalassium (strain ATCC 35110 / GB-78).
RECA_CHLTA Protein recA - Chlamydia trachomatis (strain A/HAR-13 / ATCC VR-571B).
RECA_CHLTB Protein recA - Chlamydia trachomatis (strain L2b/UCH-1/proctitis).
RECA_CHLTR Protein recA - Chlamydia trachomatis.
RECA_CHRSD Protein recA - Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768).
RECA_CHRVI Protein recA - Chromatium vinosum (Allochromatium vinosum).
RECA_CHRVO Protein recA - Chromobacterium violaceum.
RECA_CITK8 Protein recA - Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696).
RECA_CLAM3 Protein recA - Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382).
RECA_CLOAB Protein recA - Clostridium acetobutylicum.
RECA_CLOB8 Protein recA - Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum).
RECA_CLOBA Protein recA - Clostridium botulinum (strain Alaska E43 / type E3).
RECA_CLOBB Protein recA - Clostridium botulinum (strain Eklund 17B / type B).
RECA_CLOD6 Protein recA - Clostridium difficile (strain 630).
RECA_CLONN Protein recA - Clostridium novyi (strain NT).
RECA_CLOP1 Protein recA - Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A).
RECA_CLOPE Protein recA - Clostridium perfringens.
RECA_CLOPS Protein recA - Clostridium perfringens (strain SM101 / Type A).
RECA_CLOTE Protein recA - Clostridium tetani.
RECA_COLP3 Protein recA - Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus).
RECA_CORDI Protein recA - Corynebacterium diphtheriae.
RECA_COREF Protein recA - Corynebacterium efficiens.
RECA_CORGB Protein recA - Corynebacterium glutamicum (strain R).
RECA_CORGL Protein recA - Corynebacterium glutamicum (Brevibacterium flavum).
RECA_CORJK Protein recA - Corynebacterium jeikeium (strain K411).
RECA_CORPS Protein recA - Corynebacterium pseudotuberculosis.
RECA_CORU7 Protein recA - Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109).
RECA_COXBU Protein recA - Coxiella burnetii.
RECA_CUPTR Protein recA - Cupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424)).
RECA_CYAA5 Protein recA - Cyanothece sp. (strain ATCC 51142).
RECA_CYTH3 Protein recA - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469).
RECA_DECAR Protein recA - Dechloromonas aromatica (strain RCB).
RECA_DEIGD Protein recA - Deinococcus geothermalis (strain DSM 11300).
RECA_DEIRA Protein recA - Deinococcus radiodurans.
RECA_DELAS Protein recA - Delftia acidovorans (strain DSM 14801 / SPH-1).
RECA_DESDG Protein recA - Desulfovibrio desulfuricans (strain G20).
RECA_DESPS Protein recA - Desulfotalea psychrophila.
RECA_DESVH Protein recA - Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303).
RECA_DESVV Protein recA - Desulfovibrio vulgaris subsp. vulgaris (strain DP4).
RECA_DICNV Protein recA - Dichelobacter nodosus (strain VCS1703A).
RECA_ECO24 Protein recA - Escherichia coli O139:H28 (strain E24377A / ETEC).
RECA_ECO57 Protein recA - Escherichia coli O157:H7.
RECA_ECO5E Protein recA - Escherichia coli O157:H7 (strain EC4115 / EHEC).
RECA_ECOHS Protein recA - Escherichia coli O9:H4 (strain HS).
RECA_ECOL5 Protein recA - Escherichia coli O6:K15:H31 (strain 536 / UPEC).
RECA_ECOL6 Protein recA - Escherichia coli O6.
RECA_ECOLC Protein recA - Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks).
RECA_ECOLI Protein recA - Escherichia coli (strain K12).
RECA_ECOSE Protein recA - Escherichia coli (strain SE11).
RECA_ECOUT Protein recA - Escherichia coli (strain UTI89 / UPEC).
RECA_EHRCJ Protein recA - Ehrlichia canis (strain Jake).
RECA_EHRCR Protein recA - Ehrlichia chaffeensis (strain Arkansas).
RECA_EHRRG Protein recA - Ehrlichia ruminantium (strain Gardel).
RECA_EHRRW Protein recA - Ehrlichia ruminantium (strain Welgevonden).
RECA_ENT38 Protein recA - Enterobacter sp. (strain 638).
RECA_ENTAG Protein recA - Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans).
RECA_ENTFA Protein recA - Enterococcus faecalis (Streptococcus faecalis).
RECA_ENTFC Protein recA - Enterococcus faecium (Streptococcus faecium).
RECA_ENTGA Protein recA - Enterococcus gallinarum.
RECA_ENTHR Protein recA - Enterococcus hirae.
RECA_ENTMU Protein recA - Enterococcus mundtii.
RECA_ENTS8 Protein recA - Enterobacter sakazakii (strain ATCC BAA-894).
RECA_ERWCA Protein recA - Erwinia carotovora.
RECA_ERWCT Protein recA - Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum).
RECA_ERWT9 Protein recA - Erwinia tasmaniensis (strain DSM 17950 / Et1/99).
RECA_EXIS2 Protein recA - Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15).
RECA_FRAAA Protein recA - Frankia alni (strain ACN14a).
RECA_FRAP2 Protein recA - Francisella philomiragia subsp. philomiragia (strain ATCC 25017).
RECA_FRASC Protein recA - Frankia sp. (strain CcI3).
RECA_FRAT1 Protein recA - Francisella tularensis subsp. tularensis (strain FSC 198).
RECA_FRATF Protein recA - Francisella tularensis subsp. holarctica (strain FTA).
RECA_FRATH Protein recA - Francisella tularensis subsp. holarctica (strain LVS).
RECA_FRATM Protein recA - Francisella tularensis subsp. mediasiatica (strain FSC147).
RECA_FRATN Protein recA - Francisella tularensis subsp. novicida (strain U112).
RECA_FRATO Protein recA - Francisella tularensis subsp. holarctica (strain OSU18).
RECA_FRATT Protein recA - Francisella tularensis subsp. tularensis.
RECA_FRATW Protein recA - Francisella tularensis subsp. tularensis (strain WY96-3418).
RECA_FUSNN Protein recA - Fusobacterium nucleatum subsp. nucleatum.
RECA_GEOBB Protein recA - Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622).
RECA_GEOMG Protein recA - Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210).
RECA_GEOSL Protein recA - Geobacter sulfurreducens.
RECA_GLOVI Protein recA - Gloeobacter violaceus.
RECA_GLUOX Protein recA - Gluconobacter oxydans (Gluconobacter suboxydans).
RECA_HAEDU Protein recA - Haemophilus ducreyi.
RECA_HAEI8 Protein recA - Haemophilus influenzae (strain 86-028NP).
RECA_HAEIE Protein recA - Haemophilus influenzae (strain PittEE).
RECA_HAEIG Protein recA - Haemophilus influenzae (strain PittGG).
RECA_HAEIN Protein recA - Haemophilus influenzae.
RECA_HAES1 Protein recA - Haemophilus somnus (strain 129Pt) (Histophilus somni (strain 129Pt)).
RECA_HAES2 Protein recA - Haemophilus somnus (strain 2336) (Histophilus somni (strain 2336)).
RECA_HAHCH Protein recA - Hahella chejuensis (strain KCTC 2396).
RECA_HALHL Protein recA - Halorhodospira halophila (strain DSM 244 / SL1) (Ectothiorhodospira halophila (strain DSM 244 / SL1)).
RECA_HELAH Protein recA - Helicobacter acinonychis (strain Sheeba).
RECA_HELHP Protein recA - Helicobacter hepaticus.
RECA_HELMI Protein recA - Heliobacterium modesticaldum (strain ATCC 51547 / Ice1).
RECA_HELP2 Protein recA - Helicobacter pylori (strain P12).
RECA_HELPG Protein recA - Helicobacter pylori (strain G27).
RECA_HELPH Protein recA - Helicobacter pylori (strain HPAG1).
RECA_HELPJ Protein recA - Helicobacter pylori J99 (Campylobacter pylori J99).
RECA_HELPS Protein recA - Helicobacter pylori (strain Shi470).
RECA_HELPY Protein recA - Helicobacter pylori (Campylobacter pylori).
RECA_HERA2 Protein recA - Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785).
RECA_HERAR Protein recA - Herminiimonas arsenicoxydans.
RECA_HERSE Protein recA - Herbaspirillum seropedicae.
RECA_IDILO Protein recA - Idiomarina loihiensis.
RECA_JANMA Protein recA - Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis).
RECA_KINRD Protein recA - Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216).
RECA_KLEP3 Protein recA - Klebsiella pneumoniae (strain 342).
RECA_KLEP7 Protein recA - Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578).
RECA_LACAC Protein recA - Lactobacillus acidophilus.
RECA_LACBA Protein recA - Lactobacillus brevis (strain ATCC 367 / JCM 1170).
RECA_LACDA Protein recA - Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081).
RECA_LACDB Protein recA - Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365).
RECA_LACF3 Protein recA - Lactobacillus fermentum (strain IFO 3956 / LMG 18251).
RECA_LACJO Protein recA - Lactobacillus johnsonii.
RECA_LACLC Protein recA - Lactococcus lactis subsp. cremoris (Streptococcus cremoris).
RECA_LACLM Protein recA - Lactococcus lactis subsp. cremoris (strain MG1363).
RECA_LACLS Protein recA - Lactococcus lactis subsp. cremoris (strain SK11).
RECA_LACPE Protein recA - Lactobacillus pentosus.
RECA_LACPL Protein recA - Lactobacillus plantarum.
RECA_LACRD Protein recA - Lactobacillus reuteri (strain DSM 20016).
RECA_LACRJ Protein recA - Lactobacillus reuteri (strain JCM 1112).
RECA_LACSS Protein recA - Lactobacillus sakei subsp. sakei (strain 23K).
RECA_LEGPA Protein recA - Legionella pneumophila (strain Paris).
RECA_LEGPC Protein recA - Legionella pneumophila (strain Corby).
RECA_LEGPH Protein recA - Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513).
RECA_LEGPL Protein recA - Legionella pneumophila (strain Lens).
RECA_LEGPN Protein recA - Legionella pneumophila.
RECA_LEIXX Protein recA - Leifsonia xyli subsp. xyli.
RECA_LEPBA Protein recA - Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames).
RECA_LEPBP Protein recA - Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris).
RECA_LEPIC Protein recA - Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni.
RECA_LEPIN Protein recA - Leptospira interrogans.
RECA_LEPME Protein recA - Leptospira meyeri.
RECA_LISIN Protein recA - Listeria innocua.
RECA_LISIV Protein recA - Listeria ivanovii.
RECA_LISMF Protein recA - Listeria monocytogenes serotype 4b (strain F2365).
RECA_LISMO Protein recA - Listeria monocytogenes.
RECA_LISSE Protein recA - Listeria seeligeri.
RECA_LISW6 Protein recA - Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334).
RECA_LISWE Protein recA - Listeria welshimeri.
RECA_MAGMM Protein recA - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264).
RECA_MANSM Protein recA - Mannheimia succiniciproducens (strain MBEL55E).
RECA_MARAV Protein recA - Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845)).
RECA_MESFL Protein recA - Mesoplasma florum (Acholeplasma florum).
RECA_MESSB Protein recA - Mesorhizobium sp. (strain BNC1).
RECA_METCA Protein recA - Methylococcus capsulatus.
RECA_METCL Protein recA - Methylomonas clara.
RECA_METFK Protein recA - Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875).
RECA_METFL Protein recA - Methylobacillus flagellatum.
RECA_METPP Protein recA - Methylibium petroleiphilum (strain PM1).
RECA_METRJ Protein recA - Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831).
RECA_METS4 Protein recA - Methylobacterium sp. (strain 4-46).
RECA_MYCA1 Protein recA - Mycobacterium avium (strain 104).
RECA_MYCA9 Protein recA - Mycobacterium abscessus (strain ATCC 19977 / DSM 44196).
RECA_MYCBO Protein recA - Mycobacterium bovis.
RECA_MYCGI Protein recA - Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK)).
RECA_MYCH2 Protein recA - Mycoplasma hyopneumoniae (strain 232).
RECA_MYCH7 Protein recA - Mycoplasma hyopneumoniae (strain 7448).
RECA_MYCHJ Protein recA - Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110).
RECA_MYCLE Protein recA - Mycobacterium leprae.
RECA_MYCMM Protein recA - Mycobacterium marinum (strain ATCC BAA-535 / M).
RECA_MYCMO Protein recA - Mycoplasma mobile.
RECA_MYCMS Protein recA - Mycoplasma mycoides subsp. mycoides SC.
RECA_MYCMY Protein recA - Mycoplasma mycoides.
RECA_MYCPA Protein recA - Mycobacterium paratuberculosis.
RECA_MYCPE Protein recA - Mycoplasma penetrans.
RECA_MYCPN Protein recA - Mycoplasma pneumoniae.
RECA_MYCPU Protein recA - Mycoplasma pulmonis.
RECA_MYCSJ Protein recA - Mycobacterium sp. (strain JLS).
RECA_MYCSK Protein recA - Mycobacterium sp. (strain KMS).
RECA_MYCSM RECA PROTEIN - MYCOBACTERIUM SMEGMATIS.
RECA_MYCSS Protein recA - Mycobacterium sp. (strain MCS).
RECA_MYCTU Protein recA - Mycobacterium tuberculosis.
RECA_MYCUA Protein recA - Mycobacterium ulcerans (strain Agy99).
RECA_MYCVP Protein recA - Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1).
RECA_NEIG1 Protein recA - Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090).
RECA_NEIG2 Protein recA - Neisseria gonorrhoeae (strain NCCP11945).
RECA_NEIGO Protein recA - Neisseria gonorrhoeae.
RECA_NEIMA Protein recA - Neisseria meningitidis serogroup A.
RECA_NEIMB Protein recA - Neisseria meningitidis serogroup B.
RECA_NEIMF Protein recA - Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18).
RECA_NITEC Protein recA - Nitrosomonas eutropha (strain C91).
RECA_NITEU Protein recA - Nitrosomonas europaea.
RECA_NITHX Protein recA - Nitrobacter hamburgensis (strain X14 / DSM 10229).
RECA_NITMU Protein recA - Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849).
RECA_NITSB Protein recA - Nitratiruptor sp. (strain SB155-2).
RECA_NITWN Protein recA - Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391).
RECA_NOCFA Protein recA - Nocardia farcinica.
RECA_NOCSJ Protein recA - Nocardioides sp. (strain BAA-499 / JS614).
RECA_NOSP7 Protein recA - Nostoc punctiforme (strain ATCC 29133 / PCC 73102).
RECA_OCEIH Protein recA - Oceanobacillus iheyensis.
RECA_OCHA4 Protein recA - Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168).
RECA_OENOB Protein recA - Oenococcus oeni (strain BAA-331 / PSU-1).
RECA_PARDE Protein recA - Paracoccus denitrificans.
RECA_PARL1 Protein recA - Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966).
RECA_PASHA Protein recA - Pasteurella haemolytica (Mannheimia haemolytica).
RECA_PASMU Protein recA - Pasteurella multocida.
RECA_PETMO Protein recA - Petrotoga mobilis (strain DSM 10674 / SJ95).
RECA_PHOLL Protein recA - Photorhabdus luminescens subsp. laumondii.
RECA_PHOPR Protein recA - Photobacterium profundum (Photobacterium sp. (strain SS9)).
RECA_PORG3 Protein recA - Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257).
RECA_PORGI Protein recA - Porphyromonas gingivalis (Bacteroides gingivalis).
RECA_PRERU Protein recA - Prevotella ruminicola (Bacteroides ruminicola).
RECA_PROAC Protein recA - Propionibacterium acnes.
RECA_PROM0 Protein recA - Prochlorococcus marinus (strain MIT 9301).
RECA_PROM1 Protein recA - Prochlorococcus marinus (strain NATL1A).
RECA_PROM2 Protein recA - Prochlorococcus marinus (strain MIT 9215).
RECA_PROM3 Protein recA - Prochlorococcus marinus (strain MIT 9303).
RECA_PROM4 Protein recA - Prochlorococcus marinus (strain MIT 9211).
RECA_PROM5 Protein recA - Prochlorococcus marinus (strain MIT 9515).
RECA_PROM9 Protein recA - Prochlorococcus marinus (strain MIT 9312).
RECA_PROMA Protein recA - Prochlorococcus marinus.
RECA_PROMH Protein recA - Proteus mirabilis (strain HI4320).
RECA_PROMI Protein recA - Proteus mirabilis.
RECA_PROMM Protein recA - Prochlorococcus marinus (strain MIT 9313).
RECA_PROMP Protein recA - Prochlorococcus marinus subsp. pastoris (strain CCMP1378 / MED4).
RECA_PROMS Protein recA - Prochlorococcus marinus (strain AS9601).
RECA_PROMT Protein recA - Prochlorococcus marinus (strain NATL2A).
RECA_PROVU Protein recA - Proteus vulgaris.
RECA_PSE14 Protein recA - Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6).
RECA_PSEA6 Protein recA - Pseudoalteromonas atlantica (strain T6c / BAA-1087).
RECA_PSEA7 Protein recA - Pseudomonas aeruginosa (strain PA7).
RECA_PSEAB Protein recA - Pseudomonas aeruginosa (strain UCBPP-PA14).
RECA_PSEAE Protein recA - Pseudomonas aeruginosa.
RECA_PSEE4 Protein recA - Pseudomonas entomophila (strain L48).
RECA_PSEF5 Protein recA - Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477).
RECA_PSEFL Protein recA - Pseudomonas fluorescens.
RECA_PSEOL Protein recA - Pseudomonas oleovorans.
RECA_PSEP1 Protein recA - Pseudomonas putida (strain F1 / ATCC 700007).
RECA_PSEPF Protein recA - Pseudomonas fluorescens (strain Pf0-1).
RECA_PSEPG Protein recA - Pseudomonas putida (strain GB-1).
RECA_PSEPK Protein recA - Pseudomonas putida (strain KT2440).
RECA_PSEPU Protein recA - Pseudomonas putida.
RECA_PSEPW Protein recA - Pseudomonas putida (strain W619).
RECA_PSESM Protein recA - Pseudomonas syringae pv. tomato.
RECA_PSEST Protein recA - Pseudomonas stutzeri (Pseudomonas perfectomarina).
RECA_PSETO Protein recA - Pseudomonas tolaasii.
RECA_PSEU2 Protein recA - Pseudomonas syringae pv. syringae (strain B728a).
RECA_PSYA2 Protein recA - Psychrobacter arcticus (strain DSM 17307 / 273-4).
RECA_PSYCK Protein recA - Psychrobacter cryohalolentis (strain K5).
RECA_PSYWF Protein recA - Psychrobacter sp. (strain PRwf-1).
RECA_RALEH Protein recA - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)).
RECA_RALEJ Protein recA - Ralstonia eutropha (strain JMP134) (Alcaligenes eutrophus).
RECA_RALEU Protein recA - Ralstonia eutropha (Alcaligenes eutrophus).
RECA_RALME Protein recA - Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839).
RECA_RALSO Protein recA - Ralstonia solanacearum (Pseudomonas solanacearum).
RECA_RHIE6 Protein recA - Rhizobium etli (strain CIAT 652).
RECA_RHIEC Protein recA - Rhizobium etli (strain CFN 42 / ATCC 51251).
RECA_RHIL3 Protein recA - Rhizobium leguminosarum bv. viciae (strain 3841).
RECA_RHILO Protein recA - Rhizobium loti (Mesorhizobium loti).
RECA_RHILP RECA PROTEIN - RHIZOBIUM LEGUMINOSARUM (BIOVAR PHASEOLI).
RECA_RHILV Protein recA - Rhizobium leguminosarum bv. viciae.
RECA_RHILW Protein recA - Rhizobium leguminosarum bv. trifolii (strain WSM2304).
RECA_RHIME Protein recA - Rhizobium meliloti (Sinorhizobium meliloti).
RECA_RHOBA Protein recA - Rhodopirellula baltica.
RECA_RHOCA Protein recA - Rhodobacter capsulatus (Rhodopseudomonas capsulata).
RECA_RHOCS Protein recA - Rhodospirillum centenum (strain ATCC 51521 / SW).
RECA_RHOPA Protein recA - Rhodopseudomonas palustris.
RECA_RHORT Protein recA - Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255).
RECA_RHOS1 Protein recA - Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9).
RECA_RHOS5 Protein recA - Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3).
RECA_RHOSH RECA PROTEIN - RHODOBACTER SPHAEROIDES (RHODOPSEUDOMONAS SPHAEROIDES).
RECA_RHOSR Protein recA - Rhodococcus sp. (strain RHA1).
RECA_RHOVI Protein recA - Rhodopseudomonas viridis.
RECA_RICB8 Protein recA - Rickettsia bellii (strain OSU 85-389).
RECA_RICBR Protein recA - Rickettsia bellii (strain RML369-C).
RECA_RICCK Protein recA - Rickettsia canadensis (strain McKiel).
RECA_RICCN Protein recA - Rickettsia conorii.
RECA_RICFE Protein recA - Rickettsia felis (Rickettsia azadi).
RECA_RICM5 Protein recA - Rickettsia massiliae (strain Mtu5).
RECA_RICPR Protein recA - Rickettsia prowazekii.
RECA_RICTY Protein recA - Rickettsia typhi.
RECA_ROSCS Protein recA - Roseiflexus castenholzii (strain DSM 13941 / HLO8).
RECA_ROSS1 Protein recA - Roseiflexus sp. (strain RS-1).
RECA_RUBXD Protein recA - Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129).
RECA_SACD2 Protein recA - Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024).
RECA_SACEN Protein recA - Saccharopolyspora erythraea (strain NRRL 23338).
RECA_SALA4 Protein recA - Salmonella agona (strain SL483).
RECA_SALAI Protein recA - Salinispora arenicola (strain CNS-205).
RECA_SALCH Protein recA - Salmonella choleraesuis.
RECA_SALDC Protein recA - Salmonella dublin (strain CT_02021853).
RECA_SALEP Protein recA - Salmonella enteritidis PT4 (strain P125109).
RECA_SALG2 Protein recA - Salmonella gallinarum (strain 287/91 / NCTC 13346).
RECA_SALHS Protein recA - Salmonella heidelberg (strain SL476).
RECA_SALNS Protein recA - Salmonella newport (strain SL254).
RECA_SALPA Protein recA - Salmonella paratyphi A.
RECA_SALPB Protein recA - Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7).
RECA_SALPK Protein recA - Salmonella paratyphi A (strain AKU_12601).
RECA_SALSV Protein recA - Salmonella schwarzengrund (strain CVM19633).
RECA_SALTI Protein recA - Salmonella typhi.
RECA_SALTO Protein recA - Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440).
RECA_SALTY Protein recA - Salmonella typhimurium.
RECA_SERMA Protein recA - Serratia marcescens.
RECA_SERP5 Protein recA - Serratia proteamaculans (strain 568).
RECA_SHEAM Protein recA - Shewanella amazonensis (strain ATCC BAA-1098 / SB2B).
RECA_SHEB5 Protein recA - Shewanella baltica (strain OS155 / ATCC BAA-1091).
RECA_SHEB8 Protein recA - Shewanella baltica (strain OS185).
RECA_SHEB9 Protein recA - Shewanella baltica (strain OS195).
RECA_SHEDO Protein recA - Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013).
RECA_SHEFN Protein recA - Shewanella frigidimarina (strain NCIMB 400).
RECA_SHEHH Protein recA - Shewanella halifaxensis (strain HAW-EB4).
RECA_SHELP Protein recA - Shewanella loihica (strain ATCC BAA-1088 / PV-4).
RECA_SHEON Protein recA - Shewanella oneidensis.
RECA_SHEPA Protein recA - Shewanella pealeana (strain ATCC 700345 / ANG-SQ1).
RECA_SHEPC Protein recA - Shewanella putrefaciens (strain CN-32 / ATCC BAA-453).
RECA_SHESA Protein recA - Shewanella sp. (strain ANA-3).
RECA_SHESH Protein recA - Shewanella sediminis (strain HAW-EB3).
RECA_SHESM Protein recA - Shewanella sp. (strain MR-4).
RECA_SHESR Protein recA - Shewanella sp. (strain MR-7).
RECA_SHESW Protein recA - Shewanella sp. (strain W3-18-1).
RECA_SHEWM Protein recA - Shewanella woodyi (strain ATCC 51908 / MS32).
RECA_SHIB3 Protein recA - Shigella boydii serotype 18 (strain CDC 3083-94 / BS512).
RECA_SHIBS Protein recA - Shigella boydii serotype 4 (strain Sb227).
RECA_SHIDS Protein recA - Shigella dysenteriae serotype 1 (strain Sd197).
RECA_SHIF8 Protein recA - Shigella flexneri serotype 5b (strain 8401).
RECA_SHIFL Protein recA - Shigella flexneri.
RECA_SHISO Protein recA - Shigella sonnei.
RECA_SHISS Protein recA - Shigella sonnei (strain Ss046).
RECA_SILPO Protein recA - Silicibacter pomeroyi.
RECA_SINMW Protein recA - Sinorhizobium medicae (strain WSM419) (Ensifer medicae).
RECA_SODGL Protein recA - Sodalis glossinidius.
RECA_SODGM Protein recA - Sodalis glossinidius (strain morsitans).
RECA_SPIPL Protein recA - Spirulina platensis.
RECA_STAA1 Protein recA - Staphylococcus aureus (strain Mu3 / ATCC 700698).
RECA_STAA2 Protein recA - Staphylococcus aureus (strain JH1).
RECA_STAA9 Protein recA - Staphylococcus aureus (strain JH9).
RECA_STAAB Protein recA - Staphylococcus aureus (strain bovine RF122 / ET3-1).
RECA_STAAC Protein recA - Staphylococcus aureus (strain COL).
RECA_STAAE Protein recA - Staphylococcus aureus (strain Newman).
RECA_STAAM Protein recA - Staphylococcus aureus (strain Mu50 / ATCC 700699).
RECA_STAAN Protein recA - Staphylococcus aureus (strain N315).
RECA_STAAR Protein recA - Staphylococcus aureus (strain MRSA252).
RECA_STAAS Protein recA - Staphylococcus aureus (strain MSSA476).
RECA_STAAT Protein recA - Staphylococcus aureus (strain USA300 / TCH1516).
RECA_STAAU Protein recA - Staphylococcus aureus.
RECA_STAAW Protein recA - Staphylococcus aureus (strain MW2).
RECA_STAEQ Protein recA - Staphylococcus epidermidis (strain ATCC 35984 / RP62A).
RECA_STAES Protein recA - Staphylococcus epidermidis (strain ATCC 12228).
RECA_STAHJ Protein recA - Staphylococcus haemolyticus (strain JCSC1435).
RECA_STAS1 Protein recA - Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229).
RECA_STRA3 Protein recA - Streptococcus agalactiae serotype III.
RECA_STRA5 Protein recA - Streptococcus agalactiae serotype V.
RECA_STRAG Protein recA - Streptococcus agalactiae.
RECA_STRAM Protein recA - Streptomyces ambofaciens.
RECA_STRAW Protein recA - Streptomyces avermitilis.
RECA_STREM Protein recA - Streptococcus equi subsp. zooepidemicus (strain MGCS10565).
RECA_STRGC Protein recA - Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288).
RECA_STRLI Protein recA - Streptomyces lividans.
RECA_STRM5 Protein recA - Stenotrophomonas maltophilia (strain R551-3).
RECA_STRMK Protein recA - Stenotrophomonas maltophilia (strain K279a).
RECA_STRMU Protein recA - Streptococcus mutans.
RECA_STRP1 Protein recA - Streptococcus pyogenes serotype M1.
RECA_STRP2 Protein recA - Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466).
RECA_STRP3 Protein recA - Streptococcus pyogenes serotype M3.
RECA_STRP4 Protein recA - Streptococcus pneumoniae serotype 19F (strain G54).
RECA_STRP6 Protein recA - Streptococcus pyogenes serotype M6.
RECA_STRP8 Protein recA - Streptococcus pyogenes serotype M18.
RECA_STRP9 Protein recA - Streptococcus pyogenes serotype M49.
RECA_STRPB Protein recA - Streptococcus pyogenes serotype M12 (strain MGAS2096).
RECA_STRPC Protein recA - Streptococcus pyogenes serotype M12 (strain MGAS9429).
RECA_STRPD Protein recA - Streptococcus pyogenes serotype M2 (strain MGAS10270).
RECA_STRPF Protein recA - Streptococcus pyogenes serotype M4 (strain MGAS10750).
RECA_STRPG Protein recA - Streptococcus pyogenes serotype M5 (strain Manfredo).
RECA_STRPI Protein recA - Streptococcus pneumoniae (strain Hungary19A-6).
RECA_STRPM Protein recA - Streptococcus pyogenes serotype M28.
RECA_STRPN Protein recA - Streptococcus pneumoniae.
RECA_STRPS Protein recA - Streptococcus pneumoniae (strain CGSP14).
RECA_STRPZ Protein recA - Streptococcus pyogenes serotype M49 (strain NZ131).
RECA_STRR6 Protein recA - Streptococcus pneumoniae (strain ATCC BAA-255 / R6).
RECA_STRRM Protein recA - Streptomyces rimosus.
RECA_STRSV Protein recA - Streptococcus sanguinis (strain SK36).
RECA_STRT1 Protein recA - Streptococcus thermophilus (strain CNRZ 1066).
RECA_STRT2 Protein recA - Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311).
RECA_STRTD Protein recA - Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9).
RECA_STRTR Protein recA - Streptococcus thermophilus.
RECA_STRVL Protein recA - Streptomyces violaceus (Streptomyces venezuelae).
RECA_SULDN Protein recA - Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) (Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1251)).
RECA_SULNB Protein recA - Sulfurovum sp. (strain NBC37-1).
RECA_SYMTH Protein recA - Symbiobacterium thermophilum.
RECA_SYNAS Protein recA - Syntrophus aciditrophicus (strain SB).
RECA_SYNE7 Protein recA - Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2).
RECA_SYNFM Protein recA - Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB).
RECA_SYNP2 Protein recA - Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum).
RECA_SYNP6 Protein recA - Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans).
RECA_SYNPW Protein recA - Synechococcus sp. (strain WH7803).
RECA_SYNPX Protein recA - Synechococcus sp. (strain WH8102).
RECA_SYNS3 Protein recA - Synechococcus sp. (strain CC9311).
RECA_SYNS9 Protein recA - Synechococcus sp. (strain CC9902).
RECA_SYNSC Protein recA - Synechococcus sp. (strain CC9605).
RECA_SYNY3 Protein recA - Synechocystis sp. (strain PCC 6803).
RECA_THEAQ Protein recA - Thermus aquaticus.
RECA_THEEB Protein recA - Thermosynechococcus elongatus (strain BP-1).
RECA_THEM4 Protein recA - Thermosipho melanesiensis (strain BI429 / DSM 12029).
RECA_THEMA Protein recA - Thermotoga maritima.
RECA_THEP1 Protein recA - Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995).
RECA_THESQ Protein recA - Thermotoga sp. (strain RQ2).
RECA_THET2 Protein recA - Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039).
RECA_THET8 Protein recA - Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579).
RECA_THETH Protein recA - Thermus thermophilus.
RECA_THETN Protein recA - Thermoanaerobacter tengcongensis.
RECA_THICR Protein recA - Thiomicrospira crunogena (strain XCL-2).
RECA_THIFE Protein recA - Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans).
RECA_TREDE Protein recA - Treponema denticola.
RECA_TREPA Protein recA - Treponema pallidum.
RECA_TREPS Protein recA - Treponema pallidum subsp. pallidum (strain SS14).
RECA_TROW8 Protein recA - Tropheryma whipplei (strain TW08/27) (Whipple's bacillus).
RECA_TROWT Protein recA - Tropheryma whipplei (strain Twist) (Whipple's bacillus).
RECA_UREP2 Protein recA - Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736).
RECA_UREPA Protein recA - Ureaplasma parvum (Ureaplasma urealyticum biotype 1).
RECA_UREU1 Protein recA - Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western).
RECA_VIBAN Protein recA - Vibrio anguillarum (Listonella anguillarum).
RECA_VIBC3 Protein recA - Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395).
RECA_VIBCH Protein recA - Vibrio cholerae.
RECA_VIBF1 Protein recA - Vibrio fischeri (strain ATCC 700601 / ES114).
RECA_VIBFM Protein recA - Vibrio fischeri (strain MJ11).
RECA_VIBNA Protein recA - Vibrio natriegens.
RECA_VIBPA Protein recA - Vibrio parahaemolyticus.
RECA_VIBVU Protein recA - Vibrio vulnificus.
RECA_VIBVY Protein recA - Vibrio vulnificus (strain YJ016).
RECA_WIGBR Protein recA - Wigglesworthia glossinidia brevipalpis.
RECA_WOLPM Protein recA - Wolbachia pipientis wMel.
RECA_WOLPP Protein recA - Wolbachia pipientis subsp. Culex pipiens (strain wPip).
RECA_WOLSU Protein recA - Wolinella succinogenes.
RECA_WOLTR Protein recA - Wolbachia sp. subsp. Brugia malayi (strain TRS).
RECA_XANAC Protein recA - Xanthomonas axonopodis pv. citri (Citrus canker).
RECA_XANC5 Protein recA - Xanthomonas campestris pv. vesicatoria (strain 85-10).
RECA_XANC8 Protein recA - Xanthomonas campestris pv. campestris (strain 8004).
RECA_XANCB Protein recA - Xanthomonas campestris pv. campestris (strain B100).
RECA_XANCI Protein recA - Xanthomonas campestris pv. citri.
RECA_XANCP Protein recA - Xanthomonas campestris pv. campestris.
RECA_XANOM Protein recA - Xanthomonas oryzae pv. oryzae (strain MAFF 311018).
RECA_XANOP Protein recA - Xanthomonas oryzae pv. oryzae (strain PXO99A).
RECA_XANOR Protein recA - Xanthomonas oryzae pv. oryzae.
RECA_XENBV Protein recA - Xenorhabdus bovienii.
RECA_XENNE Protein recA - Xenorhabdus nematophilus (Achromobacter nematophilus).
RECA_XYLF2 Protein recA - Xylella fastidiosa (strain M23).
RECA_XYLFA Protein recA - Xylella fastidiosa.
RECA_XYLFM Protein recA - Xylella fastidiosa (strain M12).
RECA_XYLFT Protein recA - Xylella fastidiosa (strain Temecula1 / ATCC 700964).
RECA_YERE8 Protein recA - Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081).
RECA_YERP3 Protein recA - Yersinia pseudotuberculosis serotype O:1b (strain IP 31758).
RECA_YERPA Protein recA - Yersinia pestis bv. Antiqua (strain Antiqua).
RECA_YERPB Protein recA - Yersinia pseudotuberculosis serotype IB (strain PB1/+).
RECA_YERPE Protein recA - Yersinia pestis.
RECA_YERPG Protein recA - Yersinia pestis bv. Antiqua (strain Angola).
RECA_YERPN Protein recA - Yersinia pestis bv. Antiqua (strain Nepal516).
RECA_YERPP Protein recA - Yersinia pestis (strain Pestoides F).
RECA_YERPS Protein recA - Yersinia pseudotuberculosis.
RECA_YERPY Protein recA - Yersinia pseudotuberculosis serotype O:3 (strain YPIII).
RECA_ZYMMO Protein recA - Zymomonas mobilis.

A0A7C2_9CAUD RecA recombinase - Microcystis phage Ma-LMM01.
A2ZDM0_ORYSI Putative uncharacterized protein - Oryza sativa subsp. indica (Rice).
A3Z2F8_9SYNE Protein recA - Synechococcus sp. WH 5701.
A7PE62_VITVI Chromosome chr11 scaffold_13, whole genome shotgun sequence - Vitis vinifera (Grape).
A7PWL4_VITVI Chromosome chr8 scaffold_34, whole genome shotgun sequence - Vitis vinifera (Grape).
A7PWW1_VITVI Chromosome chr19 scaffold_35, whole genome shotgun sequence - Vitis vinifera (Grape).
B1N670_SOLLC Putative recA protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum).
B1TVE1_MICLU RecA domain protein - Micrococcus luteus NCTC 2665.
B4CV92_9BACT RecA protein - Chthoniobacter flavus Ellin428.
B4F8K0_MAIZE Putative uncharacterized protein - Zea mays (Maize).
B4FNF7_MAIZE Putative uncharacterized protein - Zea mays (Maize).
B6TNM4_MAIZE DNA repair protein recA - Zea mays (Maize).
B7FQ63_PHATR Chloroplast-targeted nuclear-encoded recombinase - Phaeodactylum tricornutum CCAP 1055/1.
B7YFQ5_9BACI RecA domain protein - Geobacillus sp. Y412MC61.
B8A7R8_ORYSI Putative uncharacterized protein - Oryza sativa subsp. indica (Rice).
B9HDY6_POPTR Predicted protein - Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa).
B9RK79_RICCO DNA repair protein reca, putative - Ricinus communis (Castor bean).
B9T6M8_RICCO DNA repair protein reca, putative - Ricinus communis (Castor bean).
Q05FN0_CARRP Protein recA - Carsonella ruddii (strain PV).
Q0GU25_9LACT Protein recA - Lactococcus lactis.
Q3DNP3_STRAG Protein recA - Streptococcus agalactiae 515.
Q3F0X4_BACTI Protein recA - Bacillus thuringiensis serovar israelensis ATCC 35646.
Q4ECD9_9RICK Protein recA - Wolbachia endosymbiont of Drosophila ananassae.
Q53QJ3_ORYSJ Os11g0302700 protein - Oryza sativa subsp. japonica (Rice).
Q5N6Y9_ORYSJ Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice).
Q6ASS3_ORYSJ DNA repair protein recA, putative - Oryza sativa subsp. japonica (Rice).
Q7F1X7_ORYSJ Putative RecA protein - Oryza sativa subsp. japonica (Rice).
Q948V7_CHLRE Chloroplast DNA recombination protein RECA - Chlamydomonas reinhardtii.
RECA3_ARATH DNA repair protein recA homolog 3, mitochondrial - Arabidopsis thaliana (Mouse-ear cress).
RECAM_DICDI Mitochondrial DNA repair protein recA homolog - Dictyostelium discoideum (Slime mold).
RECA_LACLA RECA PROTEIN, PLASMID - LACTOCOCCUS LACTIS (SUBSP. LACTIS) (STREPTOCOCCUS LACTIS).
RECA_MYCGE Protein recA - Mycoplasma genitalium.
RECA_TRIEI Protein recA - Trichodesmium erythraeum (strain IMS101).

A0MN30_9CAUD RecA/RadA recombinase - Thermus phage phiYS40.
A5L318_9GAMM Protein recA - Vibrionales bacterium SWAT-3.
A8MQK1_ARATH Uncharacterized protein At1g79050.2 - Arabidopsis thaliana (Mouse-ear cress).
B8A939_ORYSI Putative uncharacterized protein - Oryza sativa subsp. indica (Rice).
B9EWE7_ORYSJ Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice).
B9H9J7_POPTR Predicted protein - Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa).
Q0FH22_9RHOB Protein recA - Roseovarius sp. HTCC2601.
Q4ETQ4_LISMO Protein recA - Listeria monocytogenes str. 1/2a F6854.
RECA4_ARATH Putative DNA repair protein recA homolog 4 - Arabidopsis thaliana (Mouse-ear cress).

A2PZD0_CHLRE DNA recombination protein RecA, chloroplast - Chlamydomonas reinhardtii.
A4AAG4_9GAMM Protein recA - Congregibacter litoralis KT71.
A5LPZ1_STRPN Protein recA - Streptococcus pneumoniae SP6-BS73.
A5LPZ2_STRPN Protein recA - Streptococcus pneumoniae SP6-BS73.
A7BT78_9GAMM Protein recA - Beggiatoa sp. PS.
A7KV38_9VIRU RecA - Bacillus phage 0305phi8-36.
A8L2Z2_FRASN Protein recA - Frankia sp. (strain EAN1pec).
A9D6C9_9GAMM Protein recA - Shewanella benthica KT99.
A9D6D2_9GAMM Protein recA - Shewanella benthica KT99.
B0AW67_BACAN Protein recA - Bacillus anthracis str. A0488.
B0Q480_BACAN Protein recA - Bacillus anthracis str. A0193.
B0Q481_BACAN Protein recA - Bacillus anthracis str. A0193.
B0QMY2_BACAN Protein recA - Bacillus anthracis str. A0442.
B0QMY3_BACAN Protein recA - Bacillus anthracis str. A0442.
B1EZA0_BACAN Protein recA - Bacillus anthracis str. A0389.
B1EZA1_BACAN Protein recA - Bacillus anthracis str. A0389.
B1GKQ8_BACAN Protein recA - Bacillus anthracis str. A0465.
B1GKQ9_BACAN Protein recA - Bacillus anthracis str. A0465.
B1UQY9_BACAN RecA protein, group I intron-containing - Bacillus anthracis str. A0174.
B1UQZ0_BACAN RecA protein - Bacillus anthracis str. A0174.
B2QE90_9BACL Calcium-transporting ATPase - Exiguobacterium sp. AT1b.
B2QE91_9BACL RecA domain protein - Exiguobacterium sp. AT1b.
B3JA89_BACAN Protein RecA - Bacillus anthracis Tsiankovskii-I.
B3YTY8_BACCE Protein RecA - Bacillus cereus W.
B3YTY9_BACCE RecA protein, group I intron-containing - Bacillus cereus W.
B3Z5S2_BACCE Protein RecA - Bacillus cereus NVH0597-99.
B3ZMU1_BACCE Protein RecA - Bacillus cereus 03BB108.
B5UWT9_BACCE RecA protein - Bacillus cereus AH1134.
B5UWU0_BACCE RecA protein - Bacillus cereus AH1134.
B5VBS3_BACCE RecA protein, group I intron-containing - Bacillus cereus H3081.97.
B7HLB3_BACC7 RecA protein, group I intron-containing - Bacillus cereus (strain AH187).
B7HLB4_BACC7 Protein RecA - Bacillus cereus (strain AH187).
B7JJ57_BACC0 RecA protein, group I intron-containing - Bacillus cereus (strain AH820).
B7JJ58_BACC0 RecA protein - Bacillus cereus (strain AH820).
B9IV69_BACCE RecA protein (Recombinase A), C-terminal region - Bacillus cereus Q1.
B9IV70_BACCE RecA protein (Recombinase A), N-terminal region - Bacillus cereus Q1.
Q02AB2_SOLUE Protein recA - Solibacter usitatus (strain Ellin6076).
Q636P6_BACCZ Protein recA - Bacillus cereus (strain ZK / E33L).
Q636P7_BACCZ Protein recA - Bacillus cereus (strain ZK / E33L).
Q6HF35_BACHK Protein recA - Bacillus thuringiensis subsp. konkukian.
Q6HF36_BACHK Protein recA - Bacillus thuringiensis subsp. konkukian.

A4AAD0_9GAMM Protein recA - Congregibacter litoralis KT71.
A4TT30_YERPP Protein recA - Yersinia pestis (strain Pestoides F).
A6M3X3_YERPE Protein recA - Yersinia pestis CA88-4125.
A8ASX5_BPA51 Gp141 - Listeria phage A511 (Bacteriophage A511).
A8E2B6_BPPHE Putative recombinase A - Enterococcus phage phiEF24C (Enterococcus bacteriophage phi-EF24C).
A9QY67_YERPG Protein recA - Yersinia pestis bv. Antiqua (strain Angola).
A9ZFL1_YERPE Protein recA - Yersinia pestis biovar Orientalis str. IP275.
B0AW66_BACAN Protein recA - Bacillus anthracis str. A0488.
B3JA88_BACAN RecA protein, group I intron-containing - Bacillus anthracis Tsiankovskii-I.
B3Z5S1_BACCE RecA protein, group I intron-containing - Bacillus cereus NVH0597-99.
B3ZMU0_BACCE RecA protein, group I intron-containing - Bacillus cereus 03BB108.
B7KM99_CYAP7 Amino acid adenylation domain protein - Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155)).
B9L413_THERO RecA protein - Thermomicrobium roseum DSM 5159.
O68764_YERPE Protein recA - Yersinia pestis KIM.
Q1C030_YERPA Protein recA - Yersinia pestis bv. Antiqua (strain Antiqua).
Q1CCA9_YERPN Protein recA - Yersinia pestis bv. Antiqua (strain Nepal516).
Q30L73_BPA51 Gp72 - Listeria phage P100.
Q4N978_THEPA Putative uncharacterized protein - Theileria parva.
Q935F3_SALTI Protein recA - Salmonella typhi.
Q94CQ8_ORYSJ P0660F12.22 protein (Putative RecA protein) - Oryza sativa subsp. japonica (Rice).
Q9RID0_YERPE Protein recA - Yersinia pestis.
Scan History
SPTR57_40f 5  2000 NSINGLE    
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SERMA 95 95 -
DAEHALDVQYASKLGVNLTDLLISQPDTGE RECA_BORPE 102 102 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOLI 95 95 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEFL 93 93 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE RECA_NEIGO 94 94 -
DAEHALDPDYAAKLGVNVDDLLVSQPDTGE RECA_AZOVI 93 93 -
DAEHALDPIYAKKLGVNIDELLVSQPDTGE RECA_VIBAN 93 93 -
DAEHALDPNYAKALGVDLDNLVLSQPDTGE RECA_ACHLA 94 94 -

Motif 2 width=30
Element Seqn Id St Int Rpt
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SERMA 129 4 -
ITDALVRSGSVDLIVIDSVAALVPKAEIEG RECA_BORPE 136 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOLI 129 4 -
ITDMLVRSNAIDVIVVDSVAALVPKAEIEG RECA_PSEFL 127 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG RECA_NEIGO 128 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_AZOVI 127 4 -
ICDALARSGAIDVIVIDSVAALTPKAEIEG RECA_VIBAN 127 4 -
IAEALIKSGSIDMIVIDSVAALVPEAEIAG RECA_ACHLA 128 4 -

Motif 3 width=30
Element Seqn Id St Int Rpt
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_SERMA 167 8 -
LQARLMSQALRKLTATIKRTNCMVIFINQI RECA_BORPE 174 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOLI 167 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEFL 165 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI RECA_NEIGO 166 8 -
LQARLMSQALRKITGNIQNANCLVIFINQI RECA_AZOVI 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_VIBAN 165 8 -
LQARMMSQAMRKMSGVISKSNVVAIFINQI RECA_ACHLA 166 8 -

Motif 4 width=29
Element Seqn Id St Int Rpt
GGNALKFYASVRLDIRRIGAIKEGDEVVG RECA_SERMA 212 15 -
GGNALKFYSSVRLDIRRIGAIKKGDEVVG RECA_BORPE 219 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOLI 212 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEFL 210 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG RECA_NEIGO 211 15 -
GANALKFYASVRLDIRRTGAVKESDEVIG RECA_AZOVI 210 15 -
GGNALKFYASVRLDIRRTGSIKEGDEAVG RECA_VIBAN 210 15 -
GGRALKFFSSVRLEIRRAEAIKQGSEMIG RECA_ACHLA 211 15 -

Motif 5 width=30
Element Seqn Id St Int Rpt
VKVVKNKIAAPFKQAEFQIMYGEGINSRGE RECA_SERMA 245 4 -
VKVVKNKVAPPFKQAEFDIMYGSGISREGE RECA_BORPE 252 4 -
VKVVKNKIAAPFKQAEFQILYGEGINFYGE RECA_ECOLI 245 4 -
VKVVKNKVAPPFRQAEFQILYGKGIYLNGE RECA_PSEFL 243 4 -
VKVIKNKVAPPFRQAEFDILYGEGISWEGE RECA_NEIGO 244 4 -
VKVVKNKVAPPFRQAEFQILYGKGIYRNGE RECA_AZOVI 243 4 -
IKVVKNKIAAPFKQADTQILYGQGFNREGE RECA_VIBAN 243 4 -
VKVVKSKVAPPLKTASIDIMYGTGISRSGE RECA_ACHLA 244 4 -

Motif 6 width=18
Element Seqn Id St Int Rpt
IGQGKANACNFLKENPAI RECA_SERMA 299 24 -
IGQGKDNVREYLKEHKEM RECA_BORPE 306 24 -
IGQGKANATAWLKDNPET RECA_ECOLI 299 24 -
IGQGKANSAKFLADNPDI RECA_PSEFL 297 24 -
IGQGKDNVRVWLKENPEI RECA_NEIGO 298 24 -
IGQGKANAAKFLEDNPEV RECA_AZOVI 297 24 -
IGQGKANACKFLRENPAA RECA_VIBAN 297 24 -
LGQGRDNAKQYLEDKPEL RECA_ACHLA 298 24 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
DAEHALDPIYARKLGVQLDDLLISQPDTGE RECA_PARL1 104 104 -
DAEHALDPGYAEKLGVNVDDLLVSQPDTGE B8GQV3_9GAMM 94 94 -
DAEHALDPVYAQKLGVNVSDLLISQPDTGE RECA_METFK 94 94 -
DAEHALDPVYAKALGVDIDELIVSQPDTGE Q2N9K3_ERYLH 104 104 -
DAEHALDPVYAKKLGVDIDELVVSQPDTGE A3WBC0_9SPHN 104 104 -
DAEHALDPVYARKLGVDIDNLIVSQPDTGE Q2G8V4_NOVAD 106 106 -
DAEHALDPIYASKLGVKLDELLISQPDTGE A3VUD5_9PROT 103 103 -
DAEHALDPVYARKLGVDIDELIVSQPDTGE Q1GSD4_SPHAL 107 107 -
DAEHALDPVYARKLGVDLENLLISQPDTGE A5VQX5_BRUO2 168 168 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_BRUSU 105 105 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_BRUME 105 105 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_BRUC2 105 105 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_BRUAB 105 105 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_BRUA2 105 105 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_BRUA1 105 105 -
DAEHALDPVYAKKLGVDVDELIVSQPDTGE A5P749_9SPHN 93 93 -
DAEHALDPSYAHKLGVDVDNLLVSQPDTGE Q3SGU3_THIDA 114 114 -
DAEHALDPVYAEKLGVNMTDLLVSQPDTGE RECA_CHRVI 94 94 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_OCHA4 105 105 -
DAEHALDPQYAQKLGVNVGDLLISQPDTGE RECA_DECAR 94 94 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_BRUSI 105 105 -
DAEHALDPVYARKLGVNIDDLLISQPDAGE B6R0D5_9RHOB 104 104 -
DADDALDPQYASKLGVNVPELLISQPDTGE RECA_METCL 94 94 -
DAEHALDPSYANKLGVNIDELLLSQPDTGE B3KIK6_9BACI 68 68 -
DAEHALDPVYAQKLGVNVSDLLISQPDTGE RECA_METFL 94 94 -
DAEHALDVQYAQKLGVNLSDLLISQPDTGE B7YNW3_VARPD 106 106 -
DAEHALDPAYAKKLGVDIDELIVSQPDTGE Q1NDI6_9SPHN 133 133 -
DAEHALDPVYAKNLGVDIENLIVSQPDTGE A3DEA3_CLOTH 92 92 -
DAEHALDPVYAKNLGVDIENLIVSQPDTGE B4BH94_CLOTM 92 92 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE B0JBR8_RHILT 105 105 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE RECA_RHILW 105 105 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE RECA_RHIL3 105 105 -
DAEHALDPGYAHKLGVDLENLLISQPDTGE B7J7A9_ACIF2 94 94 -
DAEHALDPGYAHKLGVDLENLLISQPDTGE RECA_ACIF5 94 94 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE RECA_RHIE6 105 105 -
DAEHALDPIYARKLGVDVDELLISQPDTGE A8TPM0_9PROT 104 104 -
DAEHALDPVYAKKLGVNIDELIVSQPDTGE A5V3L4_SPHWW 107 107 -
DAEHALDPVYASKLGVDLDDLLISQPDTGE Q0BYM2_HYPNA 97 97 -
DAEHALDPVYARKLGVNIDELLISQPDTGE RECA_BRAJA 105 105 -
DAEHALDVTYAQKLGVNLNDLLISQPDTGE RECA_HERSE 101 101 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE B9JFS7_9RHIZ 105 105 -
DAEHALDPIYARKLGVDIDNLLISQPDAGE A0NP88_9RHOB 91 91 -
DAEHALDPVYARKLGVDVSELLVSQPDAGE A3UDY2_9RHOB 104 104 -
DAEHALDPVYARKLGVNLDDLLISQPDTGE B2IHX1_BEII9 92 92 -
DAEHALDPVYAKKLGVDIENLIVSQPDTGE B8I7D2_CLOCE 92 92 -
DAEHALDIQYAGKLGVNVNELLVSQPDTGE B2SYF4_BURPP 104 104 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_RHIME 92 92 -
DAEHALDPVYAKKLGVNIDELLLSQPDTGE RECA_BACHD 92 92 -
DAEHALDPIYAGKLGVNIDDLLVSQPDTGE RECA_PSEA6 93 93 -
DAEHALDPIYARKLGVDTENLIVSQPDTGE A6TRJ2_ALKMQ 91 91 -
DAEHALDPVYARKLGVNIDELLISQPDTGE A4YXR0_BRASO 105 105 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_MESSB 105 105 -
DAEHALDVQYAGKLGVDVGNLLISQPDTGE RECA_RALME 103 103 -
DAEHALDPVYARKLGVNVDDLLISQPDHGE A3WVK2_9BRAD 105 105 -
DAEHALDPVYARKLGVNVDDLLISQPDHGE RECA_NITWN 105 105 -
DAEHALDPIYAQKLGVNIDELLLSQPDTGE A4IMG9_GEOTN 68 68 -
DAEHALDPIYAQKLGVNIDELLLSQPDTGE B4BIW4_9BACI 93 93 -
DAEHALDPVYARKLGVNVDELLISQPDHGE Q13AC3_RHOPS 106 106 -
DAEHALDPVYAEKLGVNIDELLLSQPDTGE B7GJN3_ANOFW 138 138 -
DAEHALDPVYARKLGVDLENLLISQPDTGE RECA_RHILO 105 105 -
DAEHAFDPLYARKLGVSLDDLLVSQPDTGE RECA_RHORT 105 105 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE RECA_RHILV 92 92 -
DAEHALDPVYAEKLGVNIDELLVSQPDTGE RECA_ALTMD 93 93 -
DAEHALDPIYARKLGVDLENLLISQPDTGE RECA_SINMW 105 105 -
DAEHALDPTYAKKLGVDVDELLVSQPDTGE B5JVA0_9GAMM 93 93 -
DAEHALDPIYAEKLGVDIDNLLVSQPDTGE RECA_THICR 94 94 -
DAEHALDPVYARKLGVNLDDLLISQPDTGE B8IP29_METNO 107 107 -
DAEHALDPVYARKLGVNLDDLLISQPDTGE RECA_METS4 107 107 -
DAEHALDPTYAKKLGVDVDNLLISQPDTGE A1T002_PSYIN 96 96 -
DAEHALDTQYAAKLGVNLTDLLISQPDTGE B6BWK4_9PROT 94 94 -
DAEHALDPQYAAKLGVDLDELLISQPDTGE B7QSS1_9RHOB 105 105 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE RECA_RHIEC 105 105 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE A2UZ65_SHEPU 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHESW 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEPC 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEB9 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEB8 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEB5 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B8E8U2_9GAMM 95 95 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE RECA_RHILP 105 105 -
DAEHALDPIYARKLGVKVDDLLISQPDHGE RECA_NITHX 105 105 -
DAEHALDPVYAQKLGVNIDELLLSQPDTGE Q2B1K9_9BACI 83 83 -
DAEHALDPVYARKLGVNVDDLLISQPDHGE B3QI72_RHOPT 106 106 -
DAEHALDPVYARKLGVNVDDLLISQPDHGE RECA_RHOPA 92 92 -
DAEHALDPGYAQKLGVNLDDLLVSQPDTGE B4WEL0_9CAUL 105 105 -
DAEHALDPSYAKNLGVDIENLIVSQPDTGE A8MFC2_ALKOO 91 91 -
DAEHALDVQYASKLGVNVPELLISQPDTGE Q2T0V0_BURTA 103 103 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE A4JHK1_BURVG 103 103 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE RECA_BURS3 94 94 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE RECA_BURCJ 94 94 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE RECA_BURCE 94 94 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE Q0BC68_BURCM 103 103 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE B1YVY9_BURA4 103 103 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE B1T7P6_9BURK 103 103 -
DAEHALDVQYAAKLGVNVPELLISQPDTGE B1FQP9_9BURK 103 103 -
DAEHALDPVYARKLGVDLQSLLISQPDTGE RECA_AGRTU 105 105 -
DAEHALDPIYAKKLGVDTENLLISQPDNGE A1HUE5_9FIRM 92 92 -
DAEHALDPSYARKLGVNIDELLISQPDAGE RECA_AZOLI 105 105 -
DAEHALDTIYARKLGVNLEDLLVSQPDTGE B8ETR1_METSI 105 105 -
DAEHALDIQYASKLGVNVNDLLVSQPDTGE Q13UH6_BURXL 104 104 -
DAEHALDIQYASKLGVNVNDLLVSQPDTGE Q842H8_9BURK 104 104 -
DAEHALDIQYAGKLGVNVNDLLVSQPDTGE B1G226_9BURK 104 104 -
DAEHALDPIYAQKLGVDINELLISQPDTGE A6FSR2_9RHOB 106 106 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A1V6W5_BURMS 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE RECA_BURPS 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE RECA_BURMA 103 103 -
DAEHALDVQYAAKLGVNVPDLLISQPDTGE RECA_BURM1 94 94 -
DAEHALDVQYASKLGVNVPELLISQPDTGE Q3JVL9_BURP1 103 103 -
DAEHALDVQYAAKLGVNVPDLLISQPDTGE B9CCE0_9BURK 103 103 -
DAEHALDVQYAAKLGVNVPDLLISQPDTGE B9BTL7_9BURK 103 103 -
DAEHALDVQYAAKLGVNVPDLLISQPDTGE B9B3Z8_9BURK 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE B7CIU0_BURPS 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE B2H414_BURPS 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE B1HFF1_BURPS 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A9K5W0_BURMA 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A8KKV8_BURPS 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A8E9V2_BURPS 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A5XX15_BURMA 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A5TR11_BURMA 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A5JC36_BURMA 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A3NRX4_BURP0 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A3N690_BURP6 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A3MH63_BURM7 103 103 -
DAEHALDVQYAAKLGVNVPDLLISQPDTGE A2W7P8_9BURK 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A2S8U6_BURM9 103 103 -
DAEHALDVNYASKLGVDVGELLISQPDTGE RECA_RALEJ 103 103 -
DAEHALDIQYAGKLGVNVADLLVSQPDTGE B5WK23_9BURK 104 104 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A0KA75_BURCH 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE Q1BTW3_BURCA 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE B1JY17_BURCC 103 103 -
DAEHALDVQYASKLGVNVPELLISQPDTGE A2VVQ7_9BURK 103 103 -
DAEHALDPVYARKLGVDLENLLISQPDTGE Q1YEB7_MOBAS 105 105 -
DAEHALDPDYAEKLGVNLDDLLVSQPDTGE RECA_ALHEH 95 95 -
DAEHALDPIYARKLGVDLDELLISQPDTGE A3SNY5_9RHOB 98 98 -
DAEHALDINYARKLGVKTDDLLVSQPDTGE B3E9Z2_GEOLS 93 93 -
DAEHALDPYYAKKLGVSLEDLLISQPDTGE RECA_RHOCA 106 106 -
DAEHALDPDYAGKLGVNVDDLLVSQPDTGE A4VJP2_PSEU5 68 68 -
DAEHALDPIYARKLGVDLENLLVSQPDTGE Q0FZI3_9RHIZ 105 105 -
DAEHALDPIYARKLGVNVDELLISQPDHGE Q07R91_RHOP5 105 105 -
DAEHALDVQYASKLGVQLTDLLISQPDTGE A1WCY0_ACISJ 105 105 -
DAEHALDVQYASKLGVQLTDLLISQPDTGE B9MHR9_9BURK 105 105 -
DAEHALDPQYAKRLGVDLDELLISQPDTGE A3VJG5_9RHOB 109 109 -
DAEHALDPIYAQKLGVNIDELLLSQPDTGE B1HR36_LYSSC 68 68 -
DAEHALDPVYAQKLGVNIDELLLSQPDTGE Q8GJ70_BACME 92 92 -
DAEHALDPVYARKLGVNVDDLLISQPDHGE B6JBM2_OLICO 105 105 -
DAEHALDVSYANKLGVNVGDLLISQPDTGE RECA_RALEH 103 103 -
DAEHALDPVYASKLGVNIDELLLSQPDTGE RECA_BACSK 92 92 -
DAEHALDPQYAAKLGVDLDELLISQPDTGE B6BE26_9RHOB 104 104 -
DAEHALDVQYAGKLGVDVGNLLISQPDTGE RECA_RALEU 103 103 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE A3V9G1_9RHOB 106 106 -
DAEHALDPEYAKKLGVDTDNLLVSQPDTGE A3TMD7_9MICO 101 101 -
DAEHALDPNYAGKLGVNVDDLLVSQPDTGE A4BCJ0_9GAMM 98 98 -
DAEHALDVTYADKLGVKVPDLLISQPDTGE A3RQ47_RALSO 102 102 -
DAEHALDVTYADKLGVKVPDLLISQPDTGE B5SGP7_RALSO 102 102 -
DAEHALDVTYADKLGVKVPDLLISQPDTGE B5S8Q7_RALSO 102 102 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE B1BG38_CLOPE 96 96 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE RECA_CLOPE 96 96 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE RECA_CLOP1 96 96 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE B1RQ41_CLOPE 96 96 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE B1RIJ5_CLOPE 96 96 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE B1RAI9_CLOPE 96 96 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE B1BWW2_CLOPE 96 96 -
DAEHALDVQYAQKLGVQLSDLLISQPDTGE A1WET8_VEREI 107 107 -
DAEHALDVQYAGKLGVDVNNLLISQPDTGE B1XRZ6_POLNS 110 110 -
DAEHALDPVYARKLGVDIDELLLSQPDTGE Q8GJ73_BACME 92 92 -
DAEHALDPVYARKLGVNLDDLLISQPDTGE RECA_METRJ 107 107 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEON 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHESR 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHESM 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHESA 95 95 -
DAEHALDPQYAKKLGVDLDELLISQPDTGE B6AYP7_9RHOB 98 98 -
DAEHALDPGYAHKLGVDLENLLISQPDTGE RECA_THIFE 94 94 -
DAEHALDVQYAAKLGVNLTDLLISQPDTGE RECA_BORPD 102 102 -
DAEHALDPVYARKLGVNVDELLISQPDHGE Q218Q7_RHOPB 106 106 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEDO 95 95 -
DAEHALDPSYAQKLGVDVDSLIISQPDTGE RECA_CLOB8 96 96 -
DAEHALDPVYAKALGVNIDNLLVSQPDTGE B8G068_DESHD 95 95 -
DAEHALDPVYAKALGVNIDNLLVSQPDTGE Q24W60_DESHY 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEFN 95 95 -
DAEHALDPVYARKLGVNLDDLLISQPDTGE A9W5Y7_METEP 110 110 -
DAEHALDPVYARKLGVNLDDLLISQPDTGE B7KPS7_METC4 110 110 -
DAEHALDPVYARKLGVNLDDLLISQPDTGE B1ZC93_METPB 110 110 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SERMA 95 95 -
DAEHALDPIYAGKLGVNVDDLLLSQPDTGE Q3R742_XYLFA 93 93 -
DAEHALDPIYAGKLGVNVDDLLLSQPDTGE RECA_XYLFM 93 93 -
DAEHALDPIYAGKLGVNVDDLLLSQPDTGE Q3RE83_XYLFA 93 93 -
DAEHALDPIYARKLGVNLDDLLISQPDAGE A7IMQ9_XANP2 105 105 -
DAEHALDIQYAQKLGVNLQDLLISQPDTGE Q122H4_POLSJ 112 112 -
DAEHALDPVYAKALGVDIDNLIVSQPDTGE RECA_CLONN 93 93 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE Q2C9X3_9RHOB 107 107 -
DAEHALDPVYARKLGVNIDELLISQPDTGE A5EMM4_BRASB 105 105 -
DAEHALDPQYAKKLGVDIDELLISQPDTGE A9E4G3_9RHOB 106 106 -
DAEHALDPDYAGKLGVNVDDLLVSQPDTGE B7V8D1_PSEA8 93 93 -
DAEHALDPDYAGKLGVNVDDLLVSQPDTGE RECA_PSEAE 93 93 -
DAEHALDPDYAGKLGVNVDDLLVSQPDTGE RECA_PSEAB 93 93 -
DAEHALDPDYAGKLGVNVDDLLVSQPDTGE RECA_PSEA7 93 93 -
DAEHALDIQYAQKLGVNLQELLISQPDTGE A1VUC3_POLNA 104 104 -
DAEHALDPVYAGKLGVDLGELLISQPDTGE Q0AQY8_MARMM 105 105 -
DAEHALDPVYAKRLGVNIDDLVVSQPDTGE RECA_CLOPS 96 96 -
DAEHALDPSYAYKLGVNLDNLLVSQPDNGE B8H3I7_CAUCR 105 105 -
DAEHALDPSYAYKLGVNLDNLLVSQPDNGE RECA_CAUCR 105 105 -
DAEHALDPIYARKLGVDVDNLLISQPDTGE RECA_ACICJ 92 92 -
DAEHALDPVYAQKLGVNIDELLLSQPDTGE RECA_BACLD 92 92 -
DAEHALDPVYAQKLGVNIDELLLSQPDTGE RECA_BACLI 92 92 -
DAEHALDPLYASKLGVNIDELLLSQPDTGE B1DLF1_9BACL 92 92 -
DAEHALDVQYASRLGVDVNNLLISQPDTGE A4SZY2_POLSQ 110 110 -
DAEHALDPSYAQKLGVKVDELLVSQPDTGE RECA_LEGPN 94 94 -
DAEHALDPSYAQKLGVKVDELLVSQPDTGE RECA_LEGPL 94 94 -
DAEHALDPSYAQKLGVKVDELLVSQPDTGE RECA_LEGPH 94 94 -
DAEHALDPSYAQKLGVKVDELLVSQPDTGE RECA_LEGPC 94 94 -
DAEHALDPSYAQKLGVKVDELLVSQPDTGE RECA_LEGPA 94 94 -
DAEHALDPSYAQKLGVKVDELLVSQPDTGE B2C321_LEGPN 94 94 -
DAEHALDIQYAQKLGVNLQDLLISQPDTGE B1XY03_LEPCP 102 102 -
DAEHALDPIYAGKLGVKVDDLLVSQPDTGE B9DEP2_9GAMM 93 93 -
DAEHALDPQYARKLGVDLDELLISQPDTGE B9NRH1_9RHOB 103 103 -
DAEHALDPGYARKLGVNIDDLLLSQPDAGE RECA_GLUOX 91 91 -
DAEHALDTGYAQKLGVNLNDLLISQPDTGE B7X245_COMTE 103 103 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE RECA_BACCN 92 92 -
DAEHALDPIYAGKLGVNVDDLLLSQPDTGE RECA_XYLFA 93 93 -
DAEHALDPIYARKLGVNLDDLLISQPDAGE A8ICX1_AZOC5 105 105 -
DAEHALDPVYAEKLGVNIKDLLVSQPDTGE A4C6Y7_9GAMM 93 93 -
DAEHALDPSYARNLGVDTENLIVSQPDTGE RECA_CLOBA 96 96 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_STRMK 93 93 -
DAEHALDVNYASKLGVNVGDLLISQPDTGE RECA_CUPTR 103 103 -
DAEHALDPIYAQKLGVDIDNLLCSQPDTGE RECA_PROMI 95 95 -
DAEHALDPIYAQKLGVDIDNLLCSQPDTGE RECA_PROMH 95 95 -
DAEHALDPVYAQKLGVNIDELFVSQPDTGE Q3IFN0_PSEHT 93 93 -
DAEHALDPVYARKLGVDLQNLLISQPDTGE B9JX56_AGRVI 105 105 -
DAEHALDPVYAEKIGVNLDDLLVSQPDTGE RECA_METCA 94 94 -
DAEHALDPIYAGKLGVNVDDLLLSQPDTGE B8L292_9GAMM 114 114 -
DAEHALDVQYASKLGVNLGDLLISQPDTGE Q2KYE8_BORA1 101 101 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSE14 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEU2 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSESM 93 93 -
DAEHALDPEYAKKLGVDIDNLILSQPDNGE B5HF96_STRPR 94 94 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_ERWCT 95 95 -
DAEHALDPIYARKLGVDLDELLISQPDTGE A3VX42_9RHOB 106 106 -
DAEHALDIQYAQKLGVHVPDLLISQPDTGE A1TW37_ACIAC 103 103 -
DAEHALDPVYARKLGVDLENLLISQPDTGE A9D6F1_9RHIZ 105 105 -
DAEHALDPVYAQKLGVNIDELLLSQPDTGE RECA_BACP2 92 92 -
DAEHALDPVYAQKLGVNIDELLLSQPDTGE B4ADR5_BACPU 92 92 -
DAEHALDPLYAKKLGVNLDELLISQPDTGE A3JSX3_9RHOB 105 105 -
DAEHALDPQYAAKLGVDLDELLISQPDTGE A9EMD9_9RHOB 105 105 -
DAEHALDPQYAAKLGVDLDELLISQPDTGE A9FNG9_9RHOB 105 105 -
DAEHALDPVYAQKLGVNIEELLLSQPDTGE Q659J5_BACAM 92 92 -
DAEHALDPVYAQKLGVNIEELLLSQPDTGE RECA_BACSU 91 91 -
DAEHALDPVYAQKLGVNIEELLLSQPDTGE RECA_BACA2 92 92 -
DAEHALDPVYAQKLGVNIEELLLSQPDTGE Q8GJG2_BACAM 92 92 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE A6XC70_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALTY 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALTI 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALSV 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALPK 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALPB 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALPA 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALNS 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALHS 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALG2 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALEP 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALDC 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALCH 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SALA4 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5Q846_SALVI 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5PUL0_SALHA 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5PGV9_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5PA02_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5NNK4_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5NBF9_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5N4V4_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5MKA1_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5CBG8_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B5BYR3_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B4A2F6_SALNE 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B3YID4_SALET 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE A9MFY8_SALAR 100 100 -
DAEHALDSQYAQKLGVNLQELLISQPDTGE RECA_METPP 101 101 -
DAEHALDIQYAQNLGVNLQDLLISQPDTGE Q21RF6_RHOFD 128 128 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_XANC5 93 93 -
DAEHALDIGYARKLGVRTDDLLVSQPDTGE A5GDB6_GEOUR 93 93 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE B9KKJ7_RHOSH 116 116 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE RECA_RHOSH 92 92 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE RECA_RHOS1 106 106 -
DAEHALDIGYARKLGVKTDDLLVSQPDTGE RECA_GEOSL 94 94 -
DAEHALDPIYARKLGVDLENLFISQPDTGE RECA_BARHE 92 92 -
DAEHALDPIYAQKLGVDIDNLLCSQPDTGE RECA_SHELP 95 95 -
DAEHALDPSYARKLGVNLDELLISQPDAGE RECA_MAGMM 105 105 -
DAEHALDPIYARKLGVDIDNLLISQPDAGE B9R0H5_9RHOB 104 104 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_KLEP7 95 95 -
DAEHALDPSYARNLGVDTENLIVSQPDTGE RECA_CLOBB 96 96 -
DAEHALDPVYAKKLGVNTDDLIVSQPDTGE RECA_ZYMMO 91 91 -
DAEHALDPDYAAKLGVNVDDLLVSQPDTGE Q4IXX9_AZOVI 93 93 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_KLEP3 95 95 -
DAEHALDPVYAEKLGVNIDELLISQPDTGE RECA_COLP3 93 93 -
DAEHALDPIYAGKLGVNVDDLLLSQPDTGE RECA_XYLF2 93 93 -
DAEHALDPIYAGKLGVNVDDLLLSQPDTGE RECA_XYLFT 93 93 -
DAEHALDVQYASKLGVNLTDLLISQPDTGE RECA_BORBR 102 102 -
DAEHALDVQYASKLGVNLTDLLISQPDTGE RECA_BORPE 102 102 -
DAEHALDVQYASKLGVNLTDLLISQPDTGE RECA_BORPA 102 102 -
DAEHAFDPVYAERLGVDLDNLLISQPDTGE B9KXK1_THERO 92 92 -
DAEHALDPDYAQKLGVDINELLLSQPDTGE A4BU37_9GAMM 96 96 -
DAEHALDPEYAKKLGVDIDNLILSQPDNGE RECA_STRAW 94 94 -
DAEHALDPEYAKKLGVDIDNLILSQPDNGE RECA_STRVL 94 94 -
DAEHALDPEYAKKLGVDIDNLILSQPDNGE RECA_STRLI 94 94 -
DAEHALDPEYAKKLGVDIDNLILSQPDNGE O50487 94 94 -
DAEHALDPVYARKLGVDTDALLISQPDNGE A3N1E7_ACTP2 110 110 -
DAEHALDPVYARKLGVDTDALLISQPDNGE B3GY31_ACTP7 110 110 -
DAEHALDPVYARKLGVDTDALLISQPDNGE B0BQ84_ACTPJ 110 110 -
DAEHALDPIYAQKLGVDIDNLLCSQPDTGE RECA_ERWCA 95 95 -
DAEHALDPQYARKLGVDLDELLISQPDTGE A3TWS8_9RHOB 106 106 -
DAEHALDIGYARKLGVKTDDLLVSQPDTGE B3JUW6_9DELT 96 96 -
DAEHALDIGYARKLGVKTDDLLVSQPDTGE RECA_GEOBB 96 96 -
DAEHALDPQYAAKLGVDLDELLISQPDTGE A4ERJ5_9RHOB 104 104 -
DAEHALDIGYARKLGVRTDDLLVSQPDTGE RECA_GEOMG 94 94 -
DAEHALDPVYAKKLGVDIDNLLCSQPDTGE RECA_ERWT9 95 95 -
DAEHALDIQYAQKLGVNVSDLLVSQPDTGE B2JDB5_BURP8 104 104 -
DAEHALDPSYAHKLGVNLDDLLVAQPDTGE B4RHD9_PHEZH 105 105 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEP1 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEPU 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEPK 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEPG 93 93 -
DAEHALDVGYARKLGVRTDDLLLSQPDTGE Q1DCH8_MYXXD 97 97 -
DAEHALDVGYARKLGVRTDDLLLSQPDTGE REC2_MYXXA 97 97 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE A6BYJ2_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPY 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPS 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPP 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPN 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPG 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPB 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERPA 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERP3 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B0HV90_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B0HJM0_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B0H198_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B0GVR3_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B0GB33_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE A9ZXU8_YERPE 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE A9Z5H3_YERPE 95 95 -
DAEHALDPVYAKKLGVDIDNLLCSQPDTGE RECA_XENBV 95 95 -
DAEHALDPVYAQKLGVNIDELLVSQPDTGE A0XYZ7_9GAMM 93 93 -
DAEHALDPVYARNLGVNTDELLISQPDNGE B0QV50_HAEPR 110 110 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SERP5 95 95 -
DAEHALDPVYAKALGVNIDELLLSQPDTGE RECA_OCEIH 92 92 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_CITK8 95 95 -
DAEHALDPQYARKLGVDLDELLISQPDTGE RECA_SILPO 98 98 -
DAEHALDPDYAKKLGVDTDALLVSQPDTGE RECA_AMYMD 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_PHOLL 95 95 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_STRM5 93 93 -
DAEHALDPQYARKLGVDIDELLISQPDTGE A3SGP7_9RHOB 106 106 -
DAEHALDPQYARKLGVDIDELLISQPDTGE A3T116_9RHOB 98 98 -
DAEHALDPLYARKLGVNLDDLLISQPDAGE RECA_RHOVI 92 92 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_ENT38 95 95 -
DAEHALDPAYAKKLGVNLDELLISQPDTGE RECA_RHOS5 106 106 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B6A8B5_9ENTR 95 95 -
DAEHALDPVYARNLGVNTDDLLISQPDNGE B8F639_HAEPR 110 110 -
DAEHALDPEYAQKLGVDIDNLILSQPDNGE Q308R5_STRAA 94 94 -
DAEHALDPEYAQKLGVDIDNLILSQPDNGE RECA_STRAM 94 94 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE A1AEN9_ECOK1 100 100 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_SHISS 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_SHISO 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_SHIFL 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_SHIF8 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_SHIDS 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_SHIBS 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_SHIB3 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOUT 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOSE 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOLI 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOLC 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOL6 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOL5 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECOHS 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECO5E 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE RECA_ECO24 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B7UHB7_ECO27 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B7NSH9_ECO7I 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B7N6S9_ECOLU 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B7MKG8_ECO45 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B7M9D6_ECO8A 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B7LW30_ESCF3 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B7LEB1_ECO55 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B6ZWC2_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3XHH4_ECOLX 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3X0Z2_SHIDY 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3WLX1_ECOLX 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3ILR5_ECOLX 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3I8V5_ECOLX 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3HQ29_ECOLX 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3HDP6_ECOLX 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3BYJ2_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3BJ81_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3B4W2_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3ANH0_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B3A6T9_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B2PF74_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B2P7H8_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B2NRK8_ECO57 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B2N1H9_ECOLX 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B1LQ17_ECOSM 95 95 -
DAEHALDPIYARKLGVDIDNLLCSQPDTGE B1EGX3_9ESCH 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEHH 95 95 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEFL 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSETO 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEE4 93 93 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEPW 93 93 -
DAEHALDPGYAKKLGVNLDELLISQPDTGE B5JZH2_9RHOB 105 105 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE A1AZL5_PARDP 106 106 -
DAEHALDPIYAQKLGVNIDELLLSQPDTGE A3ICA9_9BACI 92 92 -
DAEHALDPEYAKKLGVDIDSLILSQPDNGE B1VXV8_STRGG 94 94 -
DAEHALDPQYAKKLGVDLDELLISQPDTGE Q1GHA3_SILST 105 105 -
DAEHALDPSYARKLGVDIDNLIVSQPDTGE RECA_CLOTE 93 93 -
DAEHALDPGYARKLGVDVDNLLISQPDAGE RECA_ACEPO 97 97 -
DAEHALDPVYAQKLGVDIDNLLCSQPDTGE B8CJQ6_9GAMM 95 95 -
DAEHALDPIYARKLGVDVDNLLISQPDAGE Q0BSC0_GRABC 98 98 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEPA 95 95 -
DAEHALDPIYAEALGVNVDDLLISQPDTGE RECA_IDILO 93 93 -
DAEHALDPVYAKKLGVDIDNLLCSQPDTGE RECA_XENNE 95 95 -
DAEHALDPVYAQKLGVNIDELLISQPDTGE B7DS99_9BACL 92 92 -
DAEHALDIHYARKLGVRTDDLLVSQPDTGE Q3A1W3_PELCD 95 95 -
DAEHALDVTYADKLGVKVPDLLISQPDTGE RECA_RALSO 102 102 -
DAEHALDPQYAEKLGVNVDELLVSQPDTGE A3JHQ1_9ALTE 93 93 -
DAEHALDSQYAQKLGVNVQDLLISQPDNGE RECA_NITMU 94 94 -
DAEHALDAIYAGKLGVKVEDLLVSQPDTGE A9KG26_COXBN 93 93 -
DAEHALDAIYAGKLGVKVEDLLVSQPDTGE RECA_COXBU 93 93 -
DAEHALDAIYAGKLGVKVEDLLVSQPDTGE B6J042_COXB2 93 93 -
DAEHALDAIYAGKLGVKVEDLLVSQPDTGE A9ZH63_COXBU 93 93 -
DAEHALDAIYAGKLGVKVEDLLVSQPDTGE A9NCN5_COXBR 93 93 -
DAEHALDVGYAEKLGVNITDLLISQPDTGE RECA_AZOSB 94 94 -
DAEHALDPIYAEKLGVDVDSLLVSQPDTGE Q2BQV7_9GAMM 93 93 -
DAEHALDVTYADKIGVSVPDLLISQPDTGE A7CFE0_BURPI 191 191 -
DAEHALDVTYADKIGVSVPDLLISQPDTGE B2UGD9_RALPJ 102 102 -
DAEHALDPVYARKLGVNVDELLISQPDHGE Q2ITM5_RHOP2 107 107 -
DAEHALDVGYARKLGVRTDDLLLSQPDTGE Q08Y00_STIAU 97 97 -
DAEHALDVSYAKKLGVNCDELLVSQPDTGE B8FL00_9DELT 95 95 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A1EPV0_VIBCH 151 151 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE RECA_VIBCH 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE RECA_VIBC3 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A6XXS5_VIBCH 151 151 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A6AEW1_VIBCH 151 151 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A6A6C3_VIBCH 151 151 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A3GQD3_VIBCH 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A3ENA6_VIBCH 151 151 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A3EGF8_VIBCH 151 151 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A2PUQ2_VIBCH 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A2PKZ0_VIBCH 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A2P8I1_VIBCH 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE A1F832_VIBCH 93 93 -
DAEHALDPIYAKKLGVNIDDLLVSQPDNGE Q45ND1_MORCA 94 94 -
DAEHALDPQYARKLGVDLDELLISQPDTGE A3K228_9RHOB 98 98 -
DAEHALDIGYARKLGVKTDDLLVSQPDTGE B9M365_9DELT 93 93 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_YERE8 95 95 -
DAEHALDPGYAFKLGVNLDNLLVSQPDNGE RECA_CAUSK 105 105 -
DAEHALDPIYARKLGVNTDDLYVTQPDTGE RECA_DICNV 94 94 -
DAEHALDPTYAKRLGVDIDELLISQPDAGE Q0FAQ7_9RHOB 105 105 -
DAEHALDPQYARKLGVDIDELLISQPDTGE B7RH74_9RHOB 106 106 -
DAEHALDPDYAGKLGVNVDDLLVSQPDTGE RECA_PSEST 93 93 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE A9M0G4_NEIM0 69 69 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE RECA_NEIMF 94 94 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE RECA_NEIGO 94 94 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE RECA_NEIG2 94 94 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE RECA_NEIG1 94 94 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE Q1KMW2_NEIME 94 94 -
DAEHALDPVYAAKLGVNVDDLLLSQPDTGE RECA_XANOM 93 93 -
DAEHALDPVYAAKLGVNVDDLLLSQPDTGE RECA_XANOR 93 93 -
DAEHALDPVYAAKLGVNVDDLLLSQPDTGE RECA_XANOP 93 93 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHEWM 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_ENTS8 95 95 -
DAEHALDVTYAQKLGINLSELLISQPDTGE RECA_HERAR 101 101 -
DAEHALDPIYAEALGVRVDDLLVSQPDTGE A3WM74_9GAMM 93 93 -
DAEHALDPEYAGKLGVDIDNLLVSQPDTGE RECA_FRAAA 95 95 -
DAEHALDVTYAQKLGINLSDLLISQPDTGE RECA_JANMA 101 101 -
DAEHALDPVYAKNLGVDIENLLVSQPDTGE A5D2R8_PELTS 93 93 -
DAEHALDPSYAERLGVDVDNLLVSQPDSGE Q0F3T6_9PROT 92 92 -
DAEHALDAIYAGKLGVKVEDLLVSQPDTGE B6J6Y7_COXB1 93 93 -
DAEHALDPVYAEKLGVNVDDLIISQPDNGE RECA_SACD2 93 93 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE B6FH76_9ENTR 100 100 -
DVEHALDPVYAQALGVDIDSLLVSQPDTGE B0P6Q8_9FIRM 111 111 -
DAEHALDPVYARKLGVDIDALLISQPDNGE RECA_HAEDU 109 109 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_XANC8 93 93 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_XANCP 93 93 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_XANCB 93 93 -
DAEHALDPQYARALGVDIDNLVVSQPDTGE RECA_CLOAB 93 93 -
DAEHALDPVYAKKLGVNTDDLIVSQPDTGE Q8GF01_ZYMMO 106 106 -
DAEHALDVGYAEKLGVNIQDLLISQPDTGE RECA_AZOSE 94 94 -
DAEHALDPDYAEAVGVDINDLLVSQPDTGE RECA_HALHL 95 95 -
DAEHALDPSYAEKLGVDLDSLLVSQPDTGE Q1MYV6_9GAMM 93 93 -
DAEHALDPVYAEKLGVSVDDLIVSQPDTGE Q1YR87_9GAMM 93 93 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SHESH 95 95 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE RECA_PARDE 106 106 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEF5 93 93 -
DAEHALDPGYAEKLGVNIDDMLVSQPDTGE A0YD74_9GAMM 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ16_MYCSM 96 96 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE RECA_MYCSM 96 96 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE Q1KMW1_NEIME 94 94 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE RECA_NEIMB 94 94 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE RECA_NEIMA 94 94 -
DAEHAFDPVYARKLGVKVEELYLSQPDTGE Q1KMW8_NEIME 94 94 -
DAEHALDPDYAAKLGVDTDALLVSQPDTGE RECA_KINRD 95 95 -
DAEHALDPVYARKLGVDIDNLLCSQPDTGE RECA_SHEAM 95 95 -
DAEHALDPVYARKLGVDLDELLISQPDTGE A6E088_9RHOB 106 106 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ28_9MYCO 96 96 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B2PTZ5_PROST 106 106 -
DAEHALDVQYAAKLGVNLPDLLISQPDTGE A6GU74_9BURK 102 102 -
DAENALDPVYAQKLGVNVEDLLISQPDTGE RECA_CHRVO 95 95 -
DAEHALDPGYARKLGVDVDNLLISQPDAGE A9HM16_GLUDA 128 128 -
DAEHALDPGYARKLGVDVDNLLISQPDAGE B5ZD74_GLUDA 97 97 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE Q6YI31_9ENTR 95 95 -
DAEHALDPQYAERLGVSVEDLLVSQPDTGE B6BZW2_9GAMM 94 94 -
DAEHALDPQYAERLGVSVEDLLVSQPDTGE Q3JCL0_NITOC 94 94 -
DAEHALDPVYAEKLGVNVDELLVSQPDTGE A6EV17_9ALTE 93 93 -
DAEHALDPVYAQKLGVDIENLLVSQPDTGE Q3ACX3_CARHZ 93 93 -
DAEHALDPDYAKNLGVDTDALLVSQPDSGE RECA_NOCSJ 94 94 -
DAEHALDIGYARKLGVKTDDLLVSQPDTGE A1ATV2_PELPD 99 99 -
DAEHALDTSYAQKLGVNLNEVLISQPDTGE RECA_DELAS 101 101 -
DAEHALDPIYAAKLGVDVKELLISQPDNGE RECA_HAES1 95 95 -
DAEHALDPIYAAKLGVDVKELLISQPDNGE RECA_HAES2 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE B6XAT0_9ENTR 95 95 -
DAEHALDPTYAKKLGVDLDELLISQPDTGE Q165U4_ROSDO 106 106 -
DAEHALDPIYARKLGVDLENLFVSQPDTGE RECA_BARBK 92 92 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_XANAC 93 93 -
DAEHALDPIYAAKLGVNVDDLLLSQPDTGE RECA_XANCI 93 93 -
DAEHALDPIYAQKLGVDIDALLVSQPDTGE A3XXM0_9VIBR 93 93 -
DAEHALDPIYAQKLGVDIDALLVSQPDTGE B7VK57_VIBSL 97 97 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ25_9MYCO 95 95 -
DAEHALDPDYAAKLGVNVDDLLVSQPDTGE RECA_AZOVI 93 93 -
DAEHALDPIYARKLGVDLENLFISQPDTGE RECA_BART1 92 92 -
DAEHALDPEYAGKLGVNVDDLLVSQPDTGE RECA_PSEPF 93 93 -
DAEHALDPDYAQKLGVDTDALLVSQPDTGE RECA_RHOSR 96 96 -
DAEHALDPEYAGKLGVDTDGLLVSQPDTGE RECA_FRASC 94 94 -
DAEHALDITYARKLGVNADDLLVSQPDTGE Q1K3C4_DESAC 95 95 -
DAEHALDPDYAGKLGVNVDDLLVSQPDTGE A4XWQ4_PSEMY 93 93 -
DAEHALDPDYAEKLGVNVDDLIVSQPDTGE B4X4W3_9GAMM 92 92 -
DAEHALDPDYAEKLGVNVDDLIVSQPDTGE Q0VNJ9_ALCBS 92 92 -
DAEHALDPQYARKLGVDLDELLISQPDTGE A8LLK7_DINSH 106 106 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SODGL 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_SODGM 95 95 -
DAEHALDPDYARKLGVDIDALLVSQPDTGE RECA_LEIXX 95 95 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE B7HDQ4_BACC4 92 92 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE RECA_BACWK 92 92 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE RECA_BACCR 92 92 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE RECA_BACC1 92 92 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE RECA_BACAN 92 92 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE RECA_BACAH 92 92 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE Q4MMJ9_BACCE 92 92 -
DAEHAMDPVYAQKLGVNIDELLLSQPDTGE B7ITN1_BACC2 92 92 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q2M4U4_9MYCO 96 96 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ31_9MYCO 96 96 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ30_MYCFO 96 96 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ19_9MYCO 96 96 -
DAEHALDPVYAKNLGVDIENLYLSQPDHGE B9EBH1_9STAP 92 92 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_PROVU 95 95 -
DAEHALDPIYAKKLGVNIDELLISQPDTGE Q1ZCX1_9GAMM 96 96 -
DAEHALDPAYAKNIGVDIDNLYISQPDNGE B7Y4S4_RUMHA 98 98 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q2M4U7_9MYCO 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE RECA_MYCA9 95 95 -
DAEHALDPIYAKKLGVDIDNLLCSQPDTGE RECA_ENTAG 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ26_MYCAB 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QGG1_9MYCO 95 95 -
DAEHALDPVYAQALGVDIDNLLVSQPDTGE RECA_SYMTH 96 96 -
DAEHALDPAYARKLGVDVDELLISQPDAGE RECA_RHOCS 104 104 -
DAEHALDPIYAAKLGVNVNELLVSQPDNGE RECA_PASMU 95 95 -
DAEHALDPIYAEKLGVNIDQLLVSQPDTGE RECA_HAHCH 93 93 -
DAEHALDPEYAGKLGVDTDALLVSQPDTGE A8L6J1_FRASN 94 94 -
DAEHALDPVYAKKLGVDIDNLLCSQPDTGE B6WZU4_9ENTR 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ18_9MYCO 96 96 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q5PXP6_LISSE 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE RECA_LISWE 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE RECA_LISW6 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE RECA_LISSE 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE RECA_LISIV 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q5S3P5_LISWE 92 92 -
DAEHALDPIYASKLGVDVKEPLVSQPDNGE RECA_ACTAC 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ22_9MYCO 96 96 -
DAEHALDVGYARKLGVRTDDLLISQPDTGE A7H7H5_ANADF 97 97 -
DAEHALDPIYARKLGVDTDGLLISQPDNGE A7JUT5_PASHA 108 108 -
DAEHALDPIYARKLGVDTDGLLISQPDNGE RECA_PASHA 108 108 -
DAEHALDPEYAKKLGVDTDALILSQPDNGE RECA_STRRM 94 94 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE B8DFS9_LISMO 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE RECA_LISMO 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE RECA_LISMF 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE RECA_LISIN 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q8G906_LISMO 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q547E3_LISMO 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q540Q2_LISIN 92 92 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q4EGT3_LISMO 92 92 -
DAEHALDPIYARKLGVDLENLFISQPDTGE RECA_BARQU 92 92 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE A6AW11_VIBHA 93 93 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE A7MYT7_VIBHB 100 100 -
DAEHALDPSYARKLGVNLDDLLISQPDAGE A4U369_9PROT 104 104 -
DAEHALDPIYAEALGVNIDELIVSQPDTGE B1CBR0_9FIRM 101 101 -
DAEHALDVLYAKNLGVDIDNLLVSQPDFGE RECA_NITSB 93 93 -
DAEHALDPDYARKLGVDTDALLVSQPDTGE RECA_NOCFA 96 96 -
DAEHALDPSYAKKLGVNIDELLVSQPDNGE RECA_LEPIC 109 109 -
DAEHALDPSYAKKLGVNIDELLVSQPDNGE RECA_LEPIN 109 109 -
DAEHALDPQYAKKLGVNLDELLISQPDTGE A4EKT9_9RHOB 106 106 -
DAEHALDPQYARKLGVDIDNLLVSQPDHGE RECA_ACICA 93 93 -
DAEHALDPIYAAKLGVDVKELLVSQPDNGE RECA_MANSM 95 95 -
DAEHALDPIYAKKLGVDIDSLLVSQPDTGE A6D4F1_9VIBR 93 93 -
DAEHALDPEYAKKLGVDIDALLVSQPDTGE B0RGY9_CLAMS 138 138 -
DAEHALDPEYAKKLGVDIDALLVSQPDTGE RECA_CLAM3 95 95 -
DAEHALDPVYAKALGVDVDNLIISQPDTGE RECA_CLOD6 95 95 -
DAEHAFDPVYAANCGVNVEDLLVSQPDTGE RECA_HERA2 94 94 -
DAEHALDPQYAAKLGVDLDELLISQPDTGE A3XAW9_9RHOB 103 103 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q8GNQ3_LISMO 92 92 -
DAEHALDPEYARALGVDTDALLVSQPDTGE RECA_SALAI 95 95 -
DVEPPLDPDYAGKLGVNVDDLLVSQPDTGE A3LE75_PSEAE 93 93 -
DAEHALDPVYARALGVDVDNLIISQPDTGE B0AAJ2_9CLOT 95 95 -
DAEHALDPAYAKKLGIDLDELLISQPDTGE A9GSY4_9RHOB 106 106 -
DAEHALDTAYAKKLGVNTDELLVSQPDTGE A8ZY66_DESOH 94 94 -
DAEHALDPIYAKKLGVDTEELLISQPDTGE Q4FMX8_PELUB 85 85 -
DAEHALDVKYAANLGVDVDNLYVSQPDFGE RECA_CAMHC 93 93 -
DAEHALDPIYAKKLGVDTEELLISQPDTGE Q1V252_9RICK 110 110 -
DAEHALDPKYAQALGVDIDNLLLSQPDTGE A8VT65_9BACI 92 92 -
DAEHALDPVYAKALGVDVENLIISQPDTGE B6FZD0_9CLOT 95 95 -
DAEHALDPVYAQALGVDIDNLYLSQPDHGE RECA_STAEQ 93 93 -
DAEHALDPVYAQALGVDIDNLYLSQPDHGE RECA_STAES 93 93 -
DAEHALDPEYARALGVDTDALLVSQPDTGE RECA_SALTO 95 95 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE Q2FHF3_STAA3 68 68 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAW 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAU 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAT 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAS 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAR 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAN 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAM 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAE 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAC 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAAB 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAA9 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAA2 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE RECA_STAA1 93 93 -
DAEHALDPEYAQALGVDIDNLYLSQPDHGE Q2FZ09_STAA8 68 68 -
DAEHALDPVYAQALGVDIDNLYLSQPDHGE B9CVM8_STACP 93 93 -
DAEHALDPDYAKKLGVDTDALLVSQPDTGE RECA_MYCGI 96 96 -
DAEHALDPEYAKKLGVDTDNLLVSQPDTGE RECA_ACIC1 95 95 -
DAEHALDPVYAKNLGVNIDDLLVAQPDTGE B7R8S2_9THEO 92 92 -
DAEHALDPVYAKNLGVNIDDLLVAQPDTGE RECA_THETN 93 93 -
DAEHALDPVYARKLGVDTDSLIVSQPDNGE A1A272_BIFAA 125 125 -
DAEHALDPVYARKLGVDTDSLIVSQPDNGE A7A8C4_BIFAD 111 111 -
DAEHALDPVYARKLGVNTDDLLISQPDNGE B9CWV3_9PAST 109 109 -
DAEHALDPVYAEALGVDIDNLYLSQPDHGE RECA_STAHJ 93 93 -
DAEHALDPGYAKKLGVNLDDLLISQPDTGE B5IXK8_9RHOB 105 105 -
DAEHALDPVYAKNIGVDIDNLYISQPDCGE B7BZK5_9FIRM 106 106 -
DAEHALDPSYAQKIGVDVESLIISQPDTGE B1QSG2_CLOBU 96 96 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ29_MYCCH 95 95 -
DAEHALDPAYARNLGVNIDELLVSQPDTGE B2A3V4_NATTJ 92 92 -
DAEHALDPEYARKLGVDVDNLILSQPDNGE B5G7B0_9ACTO 94 94 -
DAEHALDPTYAEKLGVNLDDLLVSQPDTGE RECA_CHRSD 95 95 -
DAEHALDPVYAEKLGVNVDELLVSQPDTGE RECA_MARAV 93 93 -
DAEHALDPQYAEKLGVQVDDLIMSQPDTGE B8KSF1_9GAMM 93 93 -
DAEHALDPVYAKNIGVDIDNLYISQPDNGE A5ZPC8_9FIRM 95 95 -
DAEHALDPIYAAKLGVNVDDLLISQPDTGE RECA_AERHH 93 93 -
DAEHALDPIYAEKLGVKIDDLIVSQPDTGE B8KI12_9GAMM 93 93 -
DAEHALDPAYAKNLGVNIDELLLSQPDTGE Q8GNQ2_LISMO 92 92 -
DAEHALDPIYARKLGVNVDELIISQPDTGE A0L826_MAGSM 104 104 -
DAEHALDPVYARKLGVDTDSLIVSQPDNGE B6XTI1_9BIFI 111 111 -
DAEHALDPIYAQKLGVDIDQLLCSQPDTGE RECA_ALISL 93 93 -
DAEHALDPVYAQNIGVDVDNLYISQPDTGE B0MJ53_9FIRM 95 95 -
DAEHALDVGYARKLGVRTDDLLISQPDSGE B4UGJ8_ANASK 97 97 -
DAEHALDPVYAAKLGVNIDDLLISQPDTGE B7B4G1_9FIRM 106 106 -
DAEHALDPIYAQKLGVDIDQLLVSQPDTGE Q2C123_9GAMM 93 93 -
DAEHALDPIYAQKLGVDIDQLLVSQPDTGE Q1ZN94_9VIBR 93 93 -
DAEHALDPVYAKNLGVNIEDLLVAQPDTGE B0K1B8_THEPX 92 92 -
DAEHALDPVYAKNLGVNIEDLLVAQPDTGE B0K9N2_THEP3 92 92 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE RECA_CAMJD 93 93 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE A6B6D9_VIBPA 100 100 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE RECA_VIBPA 93 93 -
DAEHALDPAYARNLGVDIDNLIVSQPDTGE B1II35_CLOBK 100 100 -
DAEHALDPAYARNLGVDIDNLIVSQPDTGE B1KWJ3_CLOBM 100 100 -
DAEHALDPIYAKKLGVNIDELLVSQPDTGE RECA_VIBAN 93 93 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE Q5QJ24_MYCCH 95 95 -
DAEHALDPSYARNLGVDIDNLIVSQPDTGE A5I4H9_CLOBH 97 97 -
DAEHALDPSYARNLGVDIDNLIVSQPDTGE B1QQ14_CLOBO 100 100 -
DAEHALDPSYARNLGVDIDNLIVSQPDTGE B1QEE3_CLOBO 100 100 -
DAEHALDPSYARNLGVDIDNLIVSQPDTGE A7GFZ2_CLOBL 97 97 -
DAEHALDPSYARNLGVDIDNLIVSQPDTGE A7FVX9_CLOB1 97 97 -
DAEHALDPKYAEKLGVNIDELIVSQPDTGE A4AAD1_9GAMM 93 93 -
DAEHALDPVYAKKLGVNIDQLLVSQPDTGE RECA_VIBVY 93 93 -
DAEHALDPVYAKKLGVNIDQLLVSQPDTGE RECA_VIBVU 93 93 -
DAEHALDPEYAAKLGVDIDALLVSQPDTGE A4AHJ3_9ACTN 95 95 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE B8K904_VIBPA 108 108 -
DAEHALDPQYARKLGVNLDELLISQPDTGE Q28QV9_JANSC 106 106 -
DAEHALDVSYARKIGVNTDDLLISQPDTGE RECA_SYNAS 96 96 -
DAEHALDPVYAEALGVDIDNLYLSQPDHGE B9DPC5_STACA 93 93 -
DAEHALDPEYAKKLGVDTDALLVSQPDTGE Q5QJ20_9MYCO 96 96 -
DAEHALDPIYAQKLGVDIDALLVSQPDTGE A3UV42_VIBSP 93 93 -
DAEHALDVGYARKLGVRTDDLLISQPDSGE B8J9N8_9DELT 97 97 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ27_9MYCO 96 96 -
DAEHALDPTYAEAIGVDLENLYFSQPDSGE RECA_RUBXD 93 93 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ34_9MYCO 96 96 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ32_9MYCO 96 96 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICB8 94 94 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICBR 94 94 -
DAEHALDPVYAGKVGVDIENLLISQPDTGE B1I314_DESAP 93 93 -
YLSLSLDPVYAQKLGVNIDELLLSQPDTGE B1SQM1_9BACI 26 26 -
DAEHALDPSYAKNLGVDIENLIVSQPDTGE A5N856_CLOK5 96 96 -
DAEHALDPSYAKNLGVDIENLIVSQPDTGE B9E1L6_CLOKL 96 96 -
DAEHALDPIYAAKLGVNVDDLLISQPDTGE RECA_AERSA 93 93 -
DAEHALDPQYAQKIGVNVQELLISQPDNGE RECA_NITEC 94 94 -
DAEHALDPVYAEALGVDIQNLYLSQPDHGE RECA_STAS1 93 93 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE Q1V5N0_VIBAL 93 93 -
DAEHALDPIYATKLGVNVGDLIVSQPDTGE B3PJB8_CELJU 98 98 -
DAEHAFDPIYARNIGVDIDNLLVSQPDYGE A6DBB8_9PROT 93 93 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ17_9MYCO 96 96 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE A3YK12_CAMJE 93 93 -
DAEHALDPAYASKLGVNIDELLLSQPDTGE RECA_EXIS2 92 92 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE RECA_CAMJR 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE RECA_CAMJJ 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE RECA_CAMJE 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE RECA_CAMJ8 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE B5QFR3_CAMJE 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE A5KEY5_CAMJE 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE A3ZFZ0_CAMJE 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE A3ZD29_CAMJE 93 93 -
DAEHALDVKYAKNLGVNTDDLYVSQPDFGE A3YT62_CAMJE 93 93 -
DAEHALDVKYAKNLGVDTDNLYISQPDFGE Q4HE44_CAMCO 93 93 -
DAEHALDPEYARKLGVDTDSLLVSQPDNGE A5X9E4_PROAC 95 95 -
DAEHALDPVYAKKLGVNTEELLISQPDAGE A4GJZ1_9BACT 110 110 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE A8GTM6_RICRS 113 113 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE B0BV65_RICRO 113 113 -
DAEHALDPVYAKNIGVDIDNLYISQPDNGE A9KLQ6_CLOPH 95 95 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICFE 94 94 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICTY 94 94 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICPR 94 94 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICM5 94 94 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE Q5QJ23_MYCPR 96 96 -
DAEHALDPVYARKLGVDTDSLIVSQPDNGE B1S8G9_9BIFI 177 177 -
DAEHALDPSYAKKLGVNIDELLVSQPDNGE Q04T44_LEPBJ 109 109 -
DAEHALDPSYAKKLGVNIDELLVSQPDNGE Q051G6_LEPBL 109 109 -
DAEHALDPQYAERLGVQVDDMIVSQPDTGE A0Z6J8_9GAMM 93 93 -
DAEHALDPQYAQKIGVNVQELLISQPDNGE RECA_NITEU 94 94 -
DAEHALDPSYAEKLGVNIADLLISQPDTGE A6W1Q4_MARMS 96 96 -
DAEHALDPVYAHNLGVDTDNLLVSQPDTGE Q2RJJ6_MOOTA 98 98 -
DAEHALDPEYAGKLGVDTDALLVSQPDTGE A8L0T0_FRASN 94 94 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE RECA_MYCSJ 96 96 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE RECA_MYCSS 96 96 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE RECA_MYCSK 96 96 -
DAEHALDVRYAKNLGVDTENLYISQPDFGE Q83TZ0_CAMLA 93 93 -
DAEHALDVRYAKNLGVDTENLYISQPDFGE Q845T1_CAMLA 93 93 -
DAEHALDPQYAQHLGVNIDELLLSQPDTGE Q6KCJ2_9ENTE 93 93 -
DAEHALDPQYAEKLGVKMDELIMSQPDTGE B7RWK5_9GAMM 93 93 -
DAEHALDPEYARKLGVDTDSLLVSQPDNGE Q5IV60_PROAC 95 95 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICCK 94 94 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE A8GPU6_RICAH 113 113 -
DAEHALDPSYAEKIGVNIDDLLLSQPDTGE Q47RS6_THEFY 539 539 -
DAEHALDPEYAKAIGVDTDSLLVSQPDTGE RECA_SACEN 95 95 -
DAEHALDPIYAQKLGVDIDQLLVSQPDTGE Q1Z485_PHOPR 93 93 -
DAEHALDPEYAKKLGVDTDALLVSQPDTGE Q2M4U6_9MYCO 96 96 -
DAEHALDPEYAKKLGVDTDALLVSQPDTGE Q5QJ21_9MYCO 96 96 -
DAEHALDPAYARKLGVDTDSLIVSQPDNGE B3DR86_BIFLD 132 132 -
DAEHALDPAYARKLGVDTDSLIVSQPDNGE RECA_BIFLO 111 111 -
DAEHALDPAYARKLGVDTDSLIVSQPDNGE RECA_BIFBR 111 111 -
DAEHALDPAYARKLGVDTDSLIVSQPDNGE B9AW73_BIFBR 133 133 -
DAEHALDPAYARKLGVDTDSLIVSQPDNGE B7GQG8_BIFLI 132 132 -
DAEHALDPEYAKKLGVDTDALLVSQPDTGE Q2M4U5_9MYCO 96 96 -
DAEHALDPEYARKLGVDTDSLLVSQPDNGE Q2QJS7_PROAC 95 95 -
DAEHALDPEYARKLGVDTDSLLVSQPDNGE RECA_PROAC 95 95 -
DAEHALDPGYAARIGVDIDEVLISQPDTGE B9CKI0_9ACTN 108 108 -
DAEHALDANYAEKLGVKKDDLLVSQPDTGE A8PQD9_9COXI 96 96 -
DAEHALDPQYAQRLGVNIDELLLSQPDTGE Q6KCJ0_9ENTE 93 93 -
DAEHALDPQYAQRLGVNIDELLLSQPDTGE Q6KCJ1_9ENTE 93 93 -
DAEHALDPQYAQRLGVNIDELLLSQPDTGE Q6KCK1_9ENTE 93 93 -
DAEHALDPQYAQRLGVNIDELLLSQPDTGE Q6KCJ4_9ENTE 93 93 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE Q7P9T0_RICSI 94 94 -
DAEHALDVIYAKHIGVDVDNLLVSQPDYGE B9L7U2_9PROT 93 93 -
DAEHALDPVYAKKLGVNTEELLISQPDAGE B6BSI6_9RICK 110 110 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE RECA_MYCMM 95 95 -
DAEHALDVKYAKNLGVDTENLYISQPDFGE B9KEN1_CAMLA 93 93 -
DAEHALDPVYARRLGVKIEELLISQPDTGE Q2GDN2_NEOSM 89 89 -
DAEHALDPFYAKKLGVDINNLIVSQPDSGE B9MQY3_ANATH 94 94 -
DAEHALDPIYAAKLGVDVKELFISQPDNGE A6VKZ3_ACTSZ 103 103 -
DAEHALDPVYARNIGVDIDNLYISQPDNGE A8RNZ1_9CLOT 118 118 -
DAEHALDPIYARKLGVNTDDLLVSQPDNGE RECA_PSYWF 94 94 -
DAEHALDVSYAKRLGVDAENLLVSQPDYGE RECA_WOLSU 95 95 -
DAEHALDPTYARKLGVDVENLLVSQPDYGE Q1IV37_ACIBL 97 97 -
DAEHALDPFYAKRLGVDINNLIVSQPDSGE A4XLD6_CALS8 94 94 -
DAEHALDVKYAKNLGVDTDNLYISQPDFGE RECA_CAMFE 93 93 -
DAEHALDVKYAKNLGVDTDNLYISQPDFGE RECA_CAMFF 93 93 -
DAEHALDVGYARKLGVRTDDLLISQPDSGE Q2IGM0_ANADE 97 97 -
DAEHALDPAYAKKLGVNIDELIISQPDTGE RECA_RICCN 94 94 -
DAEHALDVKYASNLGVDTDNLYVSQPDFGE B9D2D4_WOLRE 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE RECA_VIBF1 93 93 -
DAEHALDPVYAKKLGVNIDELLVSQPDTGE RECA_VIBFM 93 93 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE RECA_MYCA1 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE RECA_MYCPA 95 95 -
DAEHALDPAYAKKLGVDTDNLLVSQPDNGE A5KTF3_9BACT 105 105 -
DAEHALDPDYARKLGVDTDALLVSQPDTGE RECA_CORGB 106 106 -
DAEHALDPDYARKLGVDTDALLVSQPDTGE RECA_CORGL 106 106 -
DAEHALDPDYAQKLGVDTDALLVSQPDTGE RECA_MYCVP 96 96 -
DAEHALDPTYARALGVDIESMLISQPDTGE A6NW33_9BACE 110 110 -
DAEHALDPIYAQKLGVDIDQLLCSQPDTGE RECA_PHOPR 93 93 -
DAEHALDPAYAKKLGVNIDELLLSQPDTGE Q6KCJ9_9ENTE 93 93 -
DAEHALDPVYAEALGVDIQNLYLSQPDHGE A7KJJ5_STAXY 93 93 -
DAEHALDPEYARKLGVDTNSLLVSQPDNGE Q5IV56_PROAC 95 95 -
DAEHALDPVYAKNIGVDIDNLYISQPDCGE B7ATW2_9BACE 95 95 -
DAEHALDPAYAKKLGVNIDELLLSQPDTGE Q6KCJ8_9ENTE 93 93 -
DAEHALDPVYARNLGVDTENLLVSQPDTGE A4J5T8_DESRM 92 92 -
DAEHALDPQYARKLGVDIDNLLVSQPDNGE B7H1V4_ACIB3 93 93 -
DAEHALDPQYARKLGVDIDNLLVSQPDNGE RECA_ACIBY 93 93 -
DAEHALDPQYARKLGVDIDNLLVSQPDNGE RECA_ACIBT 93 93 -
DAEHALDPQYARKLGVDIDNLLVSQPDNGE RECA_ACIBS 93 93 -
DAEHALDPQYARKLGVDIDNLLVSQPDNGE RECA_ACIBC 93 93 -
DAEHALDVRYAKNLGVDTENLYISQPDFGE Q8VLF3_CAMLA 93 93 -
DAEHALDVKYAKNLGVDTDNLYISQPDFGE Q4HR02_CAMUP 93 93 -
DAEHALDPQYARKLGVDIDNLLVSQPDNGE B7I9U0_ACIB5 93 93 -
DAEHALDAIYAKNLGVDTDNLIISQPDTGE B0S1D5_FINM2 97 97 -
DAEHALDVKYASNLGVNTDNLYVSQPDFGE A7ZFN0_CAMC1 108 108 -
DAEHALDPQYAEKLGVNIDELLLSQPDTGE RECA_ENTFA 93 93 -
DAEHALDPSYAEKLGVNIADLLISQPDTGE A3YGX8_9GAMM 18 18 -
DAEHAFDPVYAKRCGVDVDNLLVSQPDYGE RECA_ROSCS 96 96 -
DAEHAFDPNYARKIGVNLENLLISQPDTGE B5YEC6_DICT6 91 91 -
DAEHALDPIYAGKLGVDVNELLISQPDTGE A6FHA2_9GAMM 93 93 -
DAEHALDPIYAEKLGVNLDELLLSQPDTGE A3YH37_9GAMM 99 99 -
DAEHAFDPNYARKIGVNLENLLISQPDTGE B8E2U1_9BACT 91 91 -
DAEHALDPVYARKLGVNTDDLLLSQPDNGE RECA_PSYA2 94 94 -
DAEHALDPVYARKLGVNTDDLLLSQPDNGE RECA_PSYCK 94 94 -
DAEHALDSIYARKLGVDLKNLLISQPDTGE B6F2Z4_LIBAS 93 93 -
DAEHALDINYARKLGVNTEDLLISQPDTGE RECA_BDEBA 104 104 -
DAEHALDVNYARKLGVQVEDLLISQPDYGE RECA_SYNFM 96 96 -
DAEHALDVKYAKDLGVDTENLYISQPDFGE RECA_CAMLA 93 93 -
DAEHALDPVYARALGVDTDSLLVSQPDTGE A7BD53_9ACTO 104 104 -
DAEHALDPAYAEKLGVDTDNLLVSQPDTGE B2GKH2_KOCRD 94 94 -
DAEHALDVVYAKNLGVDTDNLLVSQPDFGE RECA_SULNB 95 95 -
DAEHALDPEYAKKLGVDTDSLLVSQPDTGE RECA_MYCUA 95 95 -
DAEHALDTAYAEKLGVNIDNLLVSQPDFGE RECA_DESPS 97 97 -
DAENALDPAYATALGVNIDDLLLSQPDTGE RECA_LACBA 93 93 -
DAEHALDPLYARKLGVDINNLLVSQPDSGE Q0AXJ0_SYNWW 98 98 -
DAEHALDPVYAKNIGVNIDDLYISQPDCGE A7VB17_9CLOT 96 96 -
DAENALDPIYAEHLGVNIDDLLLSQPDTGE Q6KCK4_9LACO 93 93 -
DAEHALDPDYARKLGVDTDALLVSQPDTGE RECA_CORDI 105 105 -
DAEHALEPEYAKKLGVDTDSLLVSQPDTGE B8ZQT5_MYCLE 95 95 -
DAEHALEPEYAKKLGVDTDSLLVSQPDTGE RECA_MYCLE 95 95 -
DAEHAFDPVYAARCGVDVNNLLVSQPDYGE RECA_ROSS1 96 96 -
DAEHALDPVYARNLGVDIDNLLVSQPDTGE RECA_HELMI 96 96 -
DAENALDPVYAEHLGVNIDDLLLSQPDTGE Q6KC82_LACPL 93 93 -
DAENALDPVYAEHLGVNIDDLLLSQPDTGE RECA_LACPL 93 93 -
DAENALDPVYAEHLGVNIDDLLLSQPDTGE RECA_LACPE 93 93 -
DAENALDPVYAEHLGVNIDDLLLSQPDTGE Q6KCK2_LACPL 93 93 -
DAEHALDPIYAAKLGVNIDELLCSQPDTGE A4XPD2_PSEMY 93 93 -
DAEHALDPIYAAKLGVNIDELLCSQPDTGE RECA_PSEOL 93 93 -
DAEHALDPEYAKALGVDTDALLVSQPDTGE RECA_CORU7 103 103 -
DAEHAFDKGYAKKLGVDVDNLLISQPDNGE A6EIR5_9SPHI 95 95 -
DAEHAFDPTYARKLGVDINSLLVSQPESGE RECA_CHLP8 108 108 -
DAEHALDVKYASNLGVDTDNLYVSQPDFGE A7H0M6_CAMC5 108 108 -
DAEHALDVNYASKLGVDVENLLISQPDTGE B5YJG1_THEYD 94 94 -
DAEHALDPEYARALGVDTDALLVSQPDTGE RECA_CORJK 103 103 -
DVEHALDPTYARKLGVDVDNLLVSQPDYGE Q02AB1_SOLUE 95 95 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE RECA_VIBNA 93 93 -
DAEHAMDAEYAKRLGVNIDELILAQPDTGE B6W918_9FIRM 97 97 -
DAEHAFDPVYAARCGVNIDDLLVSQPDTGE B9LCN0_9CHLR 96 96 -
DAEHAFDPVYAARCGVNIDDLLVSQPDTGE O52394 96 96 -
DAEHALDPSYAKKLGVNVDDLLVAQPDNGE RECA_LEPME 106 106 -
DAEHALDPDYARKLGVDTDALLVSQPDTGE RECA_COREF 104 104 -
DAEHALDPVYARHLGVDTDSLIVSQPDNGE B2E872_BIFAN 112 112 -
DAEHALDPVYARHLGVDTDSLIVSQPDNGE B8DT97_BIFAN 112 112 -
DAEHALDPTYAAALGVDIDNLLISQPDTGE RECA_NOSP7 97 97 -
DAEHALDPEYAKKLGVDIDALLVSQPDSGE RECA_TROW8 97 97 -
DAEHALDPEYAKKLGVDIDALLVSQPDSGE RECA_TROWT 97 97 -
DAEHALDPIYARKLGVDIDNLLVSQPDTGE A5L337_9GAMM 95 95 -
DAEHAFDRFYAAKLGVDIDNLWISQPDNGE B5D1J8_9BACE 112 112 -
DAEHALDPVYAKNIGVDIDELYISQPDSGD A6BJF8_9FIRM 95 95 -
DAEHALDVGYARKIGVKTEDLLISQPDYGE A6GK08_9DELT 105 105 -
DAEHALDPVYARNIGVDIDELYISQPDSGD B0G577_9FIRM 96 96 -
DAEHALDPQYAEKLGVNIDELLLSQPDTGE Q6KCI8_9ENTE 93 93 -
DAEHALDVSYARKLGVRVEELLVSQPDTGE Q1DCC5_MYXXD 96 96 -
DAEHALDVSYARKLGVRVEELLVSQPDTGE REC1_MYXXA 96 96 -
DAEHALDVKYAKEIGVDTDNLLVSQPDFGE RECA_ARCB4 93 93 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE A4KP48_FRATU 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRATW 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRATT 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRATO 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRATN 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRATM 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRATH 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRATF 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRAT1 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE B4AS14_FRANO 92 92 -
DAEHALDVNYAKKLGVKTDELLISQPDYGE A9GC15_SORC5 100 100 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE A7YR40_FRATU 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE A7JFJ7_FRANO 92 92 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE A7JEW1_FRATT 92 92 -
DAEHAFDPVYAARCGVNISDLLVSQPDTGE B8GAQ9_9CHLR 96 96 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE RECA_FRAP2 92 92 -
DAENALDPQYAEHLGVNIDELLLSQPDTGE Q6KCI7_9ENTE 93 93 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE A4N0Z4_HAEIN 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE RECA_HAEIN 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE RECA_HAEIG 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE RECA_HAEIE 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE RECA_HAEI8 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE A4NW53_HAEIN 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE A4NQP5_HAEIN 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE A4NNY3_HAEIN 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE A4NIB3_HAEIN 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE A4NCS2_HAEIN 95 95 -
DAEHALDPIYAAKLGVDVKELFVSQPDNGE A4N6U0_HAEIN 95 95 -
DAEHALDPDYARKLGVDTDALLVSQPDTGE RECA_CORPS 105 105 -
DAEHALDVYYAKRLGVDTENLLVSQPDTGE RECA_HELHP 94 94 -
DAEHAFDPTYARKLGVDINALLISQPESGE A1BIQ4_CHLPD 106 106 -
DAEHALDPVYAKKIGVDIDELYISQPDSGD A7B2G7_RUMGN 94 94 -
DAEHAMDPEYAQKLGVDINNLLISQPDSGE B1GYL2_UNCTG 95 95 -
DAEHALDPQYAQKLGVNIDELLLSQPDTGE Q6KCI5_9ENTE 93 93 -
DAEHALDPQYAQKLGVNIDELLLSQPDTGE Q6KCJ7_9ENTE 93 93 -
DAEHAFDRFYADKLGVDIENLIISQPDNGE A3XGX2_9FLAO 96 96 -
DAEHALDPQYAQKLGVNIDELLLSQPDTGE RECA_ENTHR 93 93 -
DAEHALDPIYAKNLGVDIDNLLCSQPDTGE RECA_BAUCH 95 95 -
DAEHALDPKYASNLGVNIDDLLLSQPDTGE Q6KCI6_9ENTE 93 93 -
DAEHALDPTYAAALGVDIENLLVSQPDTGE A0ZKA5_NODSP 97 97 -
DAEHALDPVYAKAIGVDIDNLYISQPDYGE A5Z6J3_9FIRM 133 133 -
DAEHALDPQYAQKLGVNIDELLLSQPDTGE Q3Y1B9_ENTFC 93 93 -
DAEHALDPQYAQKLGVNIDELLLSQPDTGE RECA_ENTFC 93 93 -
DAEHAFDPSYARKLGVDINALLISQPESGE RECA_CHLCH 108 108 -
DAEHALDPIYAKNLGVDINNLLCSQPDNGE RECA_WIGBR 95 95 -
DAEHALDPSYAKKLGVNVDDLLVAQPDNGE RECA_LEPBA 106 106 -
DAEHALDPSYAKKLGVNVDDLLVAQPDNGE RECA_LEPBP 106 106 -
DAENALDPAYATALGVNIDELLLSQPDTGE Q1WT13_LACS1 104 104 -
DAEHALDPVYAKKLGVDIDALLVSQPDTGE A8T9B8_9VIBR 93 93 -
DAEHALDVGYARKLGVNLGELLVSQPDTGE B8J6W0_9DELT 69 69 -
DAENAMDPAYAEALGVDIDSLILSQPNTGE RECA_LACAC 94 94 -
DAEHALDPVYAGNIGVDIDELYISQPDSGD B7BJM4_9CLOT 95 95 -
DAEHALDPQYAQKLGVNIDELLLSQPDTGE Q6KCI9_9ENTE 93 93 -
DAEHALDVGYARKLGVNLAELLVSQPDTGE B4UDA1_ANASK 96 96 -
DAEHALDPVYAKNIGVDIDNLYISQPDTGE B0NZS5_9CLOT 95 95 -
DAEHALDPAYAKNIGVDIDELYISQPDSGD B0ND63_EUBSP 95 95 -
DAEHALDPKYSENLGVNIDNLLISQPNNGE B8CXC0_9FIRM 97 97 -
DAEHALDPTYAARIGVDIDEVLISQPDTGE B6GBT7_9ACTN 109 109 -
DAEHALDPVYAKNIGVDIDELYISQPDSGD B5CR08_9FIRM 106 106 -
DAEHAFDPTYARKLGVDINALLVSQPESGE O52393 107 107 -
DAEHAFDRFYAEKLGVDVENLWISQPDNGE A7ACC2_9PORP 112 112 -
DAEHAFDRFYAEKLGVDVENLWISQPDNGE B7B7E3_9PORP 112 112 -
DAEHALDPQYAQKLGVNIDELLLSQPDTGE RECA_ENTMU 93 93 -
DAEHAFDPSYARKLGVDINALLISQPESGE RECA_CHLL2 108 108 -
DAEHAFDRFYAAKLGVDVDNLWISQPDNGE B9ANW3_9BACT 104 104 -
DAEHAFDKFYAENLGVDIDNLIISQPDHGE A4BXB3_9FLAO 98 98 -
DAEHALDLQYAQKLGVNINSLIISQPDTGE B3CT01_ORITI 91 91 -
DAEHALDPTYASALGVDIQNLLVSQPDTGE RECA_ANASP 97 97 -
DAEHALDPTYASALGVDIQNLLVSQPDTGE RECA_ANAVA 97 97 -
DVEHALDPVYARALGVDVDSLLVSQPDTGE A7VTT9_9CLOT 112 112 -
DAEHAFDRFYAAKLGVDVDNLWISQPDNGE A6L2X2_BACV8 110 110 -
DAEHAFDRFYAAKLGVDVDNLWISQPDNGE B6W2A9_9BACE 110 110 -
DAEHALDPVYAAALGVDIENLLVSQPDTGE B5IPP8_9CHRO 133 133 -
DAEHALDTVYARKLGVNVGDLIVSQPDTGE B9KHJ1_ANAMF 102 102 -
DAEHALDPVYAKNIGVNIDELYISQPDSGD B6FS94_9CLOT 102 102 -
DAENALDPQYAEALGVNIDDLLLSQPDSGE B3XRC0_LACRE 93 93 -
DAENALDPQYAEALGVNIDDLLLSQPDSGE RECA_LACRJ 93 93 -
DAENALDPQYAEALGVNIDDLLLSQPDSGE RECA_LACRD 93 93 -
DAENAMDPKYATALGVNIDDLLLSQPDTGE RECA_LACSS 94 94 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE Q05QA7_9SYNE 107 107 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE RECA_SYNPW 107 107 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE RECA_SYNS3 107 107 -
DAEHALDPVYAAALGVDVENLLVSQPDTGE A3YUM4_9SYNE 115 115 -
DAEHAFDRYYAESLGVDIENLIISQPDNGE A6ELL5_9BACT 98 98 -
DAEHALDPQYAQKLGVNIDDLLLSQPDTGE RECA_ENTGA 93 93 -
DAEHALDPVYATSVGVDIDNLLISQPDTGE RECA_SYNE7 99 99 -
DAEHALDPVYATSVGVDIDNLLISQPDTGE RECA_SYNP6 99 99 -
DAEHALDPTYAARIGVDIDEVLISQPDTGE B6G4X5_9ACTN 109 109 -
DAEHALDPDYAAKLGVDTDALLVSQPDTGE B8HG89_9MICC 95 95 -
DAEHALDPDYAAKLGVDTDALLVSQPDTGE RECA_ARTAT 95 95 -
DAEHAFDRFYAEKLGIDIDNLIISQPDNGE A4ANZ6_9FLAO 116 116 -
DAEHALDLQYAQRLGVNINSLIISQPDTGE A5CCL6_ORITB 91 91 -
DAEHAFDPSYARKLGVDINAMLISQPESGE Q3B668_PELLD 106 106 -
DAEHALDTVYARKLGVNVGDLIVSQPDTGE RECA_ANAMM 102 102 -
DAEHALDPVYAAALGVDVSELLVSQPDSGE B0C5Y5_ACAM1 97 97 -
DAEHALDIMYARKLGVNTGDLIVSQPDTGE RECA_EHRRG 99 99 -
DAEHALDIMYARKLGVNTGDLIVSQPDTGE RECA_EHRRW 99 99 -
DAEHAFDRFYAAKLGVDVDNLFISQPDNGE Q5LG39_BACFN 81 81 -
DAEHAFDRFYAAKLGVDVDNLFISQPDNGE RECA_BACFR 81 81 -
DAEHALDPVYAAALGVDIENLLISQPDTGE B1X512_PAUCH 102 102 -
DAEHALDPIYAEKLGVDIANLLVSQPDTGE A9M4P2_9VIBR 108 108 -
DAEHAFDRFYAAKLGVDVDNLLISQPDNGE A7VAG0_BACUN 108 108 -
DAEHALDVHYAKRLGVDTENLLVSQPDTGE RECA_HELAH 95 95 -
DAEHAFDRFYAEKLGVDVENLWISQPDNGE A6LBZ5_PARD8 113 113 -
DAEHALDPGYAAKLGVDIDNLFVSQPDNGE A8DJT2_9BACT 96 96 -
DAEHALDPVYAAALGVDVSELLVSQPDSGE A8ZPF7_ACAM1 97 97 -
DAEHAFDPNYAEQLGVDTDELLISQPDTGE Q2S2C8_SALRD 97 97 -
DAEHAFDRFYAKNLGVDIDNLIISQPDHGE A4CHW1_9FLAO 96 96 -
DAEHAFDKFYAENLGVDIDNLIISQPDHGE A2TYC4_9FLAO 98 98 -
DAEHAFDRFYAAKLGVDIDNLWISQPDNGE B3JNC6_9BACE 111 111 -
DAEHALDVTYARRLGVSLAELLVSQPDTGE A7HGT3_ANADF 96 96 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE A3Z8Y2_9SYNE 103 103 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE A4CSK9_SYNPV 107 107 -
DAEHAFDRFYAAKLGVNIDDLYISQPDNGE A5ZGP0_9BACE 108 108 -
DAEHALDPDYAAKLGVDVDALLVSQPDTGE A9WQ43_RENSM 130 130 -
DAEHAFDRFYAEKLDVDIDNLIISQPDNGE A0M6E4_GRAFK 98 98 -
DAENAMDPAYAEALGVDIDSLILSQPNTGE A8YUB7_LACH4 94 94 -
DAEHALDPVYAAALGVDISELLVSQPDSGE A8ZLV5_ACAM1 97 97 -
DAEHALDVNYARKLGVRVEELLISQPDTGE Q09CN8_STIAU 69 69 -
DAEHALDPEYAAKLGVDTDALLVSQPDTGE B0BKA0_9MICC 95 95 -
DAENAMDPAYAEALGVDIDQLILSQPNTGE RECA_LACDA 94 94 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPG 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPC 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPB 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRP8 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRP6 107 107 -
DAENAMDPAYAEALGVDIDQLILSQPNTGE RECA_LACDB 94 94 -
DAEHALDVTYAKRLGVRTEDLLIAQPDTGE A3EWF7_9BACT 98 98 -
DAEHALDVTYAERLGVNADELLVSQPDYGE Q1NP94_9DELT 96 96 -
DAEHAFDRFYAAKLGVDVDNLLISQPDNGE B0NNH2_BACSE 108 108 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRMU 107 107 -
DAEHAFDRFYAAKLGVDVDNLLISQPDNGE B7AIA5_9BACE 108 108 -
DAEHAFDRFYAAKLGVDVDNLWISQPDNGE RECA_BACTN 94 94 -
DAEHALDPVYAKNIGVDIDELYISQPDSGD A5KKH5_9FIRM 96 96 -
DAEHAFDPSYARRLGVDINSMLISQPESGE Q0YRU2_9CHLB 107 107 -
DAEHALDPTYAARIGVDIDEVLISQPDTGE A4EC83_9ACTN 87 87 -
DAEHALDPVYAAALGVDVSELLVSQPDSGE B0CCZ6_ACAM1 97 97 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_SYNPX 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A5LEG8_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRR6 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPS 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPI 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRP4 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRP2 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B8ZNU7_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B2E6T2_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B2E1Y3_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B2DVL7_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B2DQY6_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B2DKH8_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B1S2Q9_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A5MWD5_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A5MPK3_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A5MHL6_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A5MA70_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A5M2X0_STRPN 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A5LTW1_STRPN 107 107 -
DAEHALDVGYARKLGVNLGELLVSQPDTGE Q2IFM8_ANADE 69 69 -
DAENAMDPAYAEALGVDIDSLILSQPNTGE A4UAE2_LACHE 94 94 -
DAEHALDPTYAKNIGVDIDNLYISQPDCGE A8SPJ7_9FIRM 103 103 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B9DW65_STRUB 107 107 -
DAEHAFDRFYAEKLGVDINNLWISQPDSGE B6YQ33_AZOPC 108 108 -
DAEHALDPEYAAKLGVDTDALLVSQPDTGE RECA_ARTS2 95 95 -
DAEHALDIMYARKLGVNTGDLIVSQPDTGE Q40IG8_EHRCH 99 99 -
DAEHALDIMYARKLGVNTGDLIVSQPDTGE RECA_EHRCR 99 99 -
DAENAMDPKYATALGVNIDELLLSQPDTGE B3WCM1_LACCB 94 94 -
DAENAMDPKYATALGVNIDELLLSQPDTGE Q03AQ0_LACC3 94 94 -
DAEHALDVHYAKRLGVDTENLLVSQPDTGE RECA_HELPH 95 95 -
DAEHALDVHYAKRLGVDTENLLVSQPDTGE RECA_HELPS 95 95 -
DAEHALDVTYAKRLGVRTEDLLIAQPDTGE B6ANE8_9BACT 98 98 -
DAEHAFDRFYAAKLGVDVDNLLISQPDNGE B3CCX8_9BACE 108 108 -
DAEHAFDRFYAEKLGVDIDNLIISQPDHGE Q26HA5_9BACT 68 68 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE B1SCW6_9STRE 115 115 -
DAEHAFDRSYAEKLGVDIENLIISQPDNGE A6H1S7_FLAPJ 96 96 -
DAEHALDVHYAKRLGVDTENLLVSQPDTGE RECA_HELPY 95 95 -
DAEHALDPAYAKVLGVNVDDLIISQPDTGE RECA_GLOVI 110 110 -
DAENAMDPAYAEALGVDIDSLILSQPNTGE Q042C2_LACGA 94 94 -
DAENAMDPAYAEALGVDIDSLILSQPNTGE RECA_LACJO 94 94 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROM1 110 110 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROMT 110 110 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE Q3CZB3_STRAG 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRA5 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRA3 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE Q9F5P5_STRAG 68 68 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE Q3JYN1_STRA1 68 68 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE Q3DQA1_STRAG 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE Q3DGG0_STRAG 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE Q3DA70_STRAG 107 107 -
DAEHALDVHYAKRLGVDTQNLLVSQPDTGE RECA_HELPG 95 95 -
DAEHAFDRFYASKLGVNIDDLYISQPDNGE B6WDW6_9BACE 108 108 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE RECA_PROMA 112 112 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STREM 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPM 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRP1 107 107 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_SYNSC 105 105 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE B9NYQ8_PROMA 101 101 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROMS 101 101 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROM9 101 101 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROM2 101 101 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROM0 101 101 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE Q1PK73_PROMA 101 101 -
DAEHAFDRFYASKLGVNIDDLYISQPDNGE A7M5K6_BACOV 108 108 -
DAEHALDPEYARKLGVDVDNLLISQPDTGE A8SMT5_9FIRM 106 106 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROM5 106 106 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROMP 106 106 -
DAEHALDPTYAAALGVDIENLLVSQPDTGE B5W6W4_SPIMA 97 97 -
DAEHAFDKTYAEKLGIDTENLLISQPDNGE A3HWX3_9SPHI 95 95 -
DAEHALDIMYARKLGVNTGDLIVSQPDTGE RECA_EHRCJ 99 99 -
DAEHAFDPTYARKLGVDINALLISQPESGE B4SFE4_PELPB 106 106 -
DAENAMDPAYATNLGVDIDSLLLSQPDTGE Q03EQ5_PEDPA 93 93 -
DAEHAFDRFYAEKLGVDLENLIISQPDNGE A3U6B8_9FLAO 98 98 -
DAEHALDPSYAAALGVNIDELLLSQPDSGE O85502 107 107 -
DVEHALDPTYAEALGVDINNLLVSQPDTGE A8S787_9FIRM 109 109 -
DAEHALDPVYSKALGVDIDNLLVAQPDNGE RECA_SYNY3 96 96 -
DAEHALDPAYAAVLGVDIQNLLISQPDTGE B8HR52_9CHRO 98 98 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRT1 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRTD 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRT2 107 107 -
DAEHAFDRFYAESLGVDIDNLIISQPDHGE A9DT53_9FLAO 98 98 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE A5GVV5_SYNR3 101 101 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE A1KM75_MYCBP 95 95 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE RECA_MYCTU 95 95 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE RECA_MYCBO 95 95 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE A5U689_MYCTA 95 95 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE A4KK14_MYCTU 95 95 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE A2VL74_MYCTU 95 95 -
DAEHALDPDYAKKLGVDTDSLLVSQPDTGE A1QV11_MYCTF 95 95 -
DAEHALDSEYAKRLGVNLNDLMVNQPDTGE Q1PYI7_9BACT 101 101 -
DAEHALDVVYAKNLGVDVENLLVSQPDYGE B6BH95_9PROT 93 93 -
DAEHALDPTYAAALGVDIQNLLISQPDTGE Q2JK85_SYNJB 92 92 -
DAEHALDPTYASALGVDTENLLVAQPDTGE B0C288_ACAM1 98 98 -
DAEHALDPSYAAALGVNIDELLLSQPDSGE RECA_STRSV 107 107 -
DAEHAFDSSYAQQLGVDVDNLLISQPDNGE B0MSV9_9BACT 99 99 -
DAEHALDVYYAKRLGVDTENLLVSQPSTGE RECA_HELPJ 95 95 -
DAEHALDVLYARKLGVSTDDLVISQPDTGE RECA_WOLPM 100 100 -
DAEHALDPNYSNALGVDIDNLLVAQPDTGE B7JZS9_CYAP8 97 97 -
DAEHALDTVYARKLGVSVGDLIVSQPDTGE Q2EFY1_ANACE 100 100 -
DAKHALDVHYAKRLGVDTENLLVSQPDTGE Q8VLM8_HELPY 95 95 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE RECA_PROM3 112 112 -
DAEHALDPVYAASLGVDIENLLVSQPDTGE RECA_PROMM 112 112 -
DAEHALDVYYAKRLGVDTENLLVSQPSTGE RECA_HELP2 95 95 -
DAEHAFDRNYAEKLNVDIENLIISQPDNGE A5FLA2_FLAJ1 96 96 -
DAEHALDPSYAAALGVNIDELLLSQPDSGE RECA_STRGC 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRP3 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPF 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRPD 107 107 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A4VSE7_STRSY 46 46 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE Q9KWG8_STRSU 68 68 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE A4VYN5_STRS2 108 108 -
DAEHAFDPSYARRLGVDINALLISQPESGE A4SD03_PROVI 107 107 -
DAEHALDPTYAAALGVDIENLLVSQPDTGE RECA_SPIPL 97 97 -
DVEHALDPKYASTCGVNLDELLISQPDTGE A8CPQ2_9CHLR 94 94 -
DVEHALDPKYASTCGVNLDELLISQPDTGE Q3Z648_DEHE1 94 94 -
DAEHAFDRFYAEKLDVDIDNLIISQPDNGE A2TR45_9FLAO 96 96 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRP9 107 107 -
DAEHAFDQSYARKLGIDIKSLLISQPESGE RECA_CHLT3 107 107 -
DAEHALDPKYAKLLGVDVDNLIVSQPDTGE A7JPI1_FRANO 92 92 -
DAEHALDTNYARRLGVKTDELLISQPDFGE B8DP00_DESVM 101 101 -
DAEHAFDRFYAEKLGIDIDNLIISQPDNGE A3J3B9_9FLAO 96 96 -
DAEHALDPTYSAALGVDINNLLVAQPDTGE RECA_CYAA5 97 97 -
DAEHALDPVYAKALGVDIDELLISQPDYGE A5TXF8_FUSNP 108 108 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRAG 107 107 -
DAEHALDPVYAKALGVDIDELLISQPDYGE RECA_FUSNN 108 108 -
DAEHAFDRFYAEKLGVDLENLIISQPDNGE A8UIA5_9FLAO 96 96 -
DAEHALDPQYAKALGVNIDELWVSQPDTGE RECA_TREDE 106 106 -
DAEHALDVAYARRLGVNTEELLISQPDFGE RECA_DESVH 101 101 -
DAEHALDVAYARRLGVNTEELLISQPDFGE RECA_DESVV 101 101 -
DAEHALDVIYARKLGVKTDDLVISQPDTGE B6Y6M6_9RICK 100 100 -
DAEHALDVIYARKLGVKTDDLVISQPDTGE RECA_WOLPP 100 100 -
DVEHALDPKYASTCGVNLDELLISQPDTGE A5FPE2_DEHSB 94 94 -
DVEHALDPKYASTCGVNLDELLISQPDTGE Q3ZW84_DEHSC 94 94 -
DAEHALDPAYAAALGVDIQNLLISQPDTGE Q2JVF7_SYNJA 92 92 -
DAEHALDPAYAAALGVNIDELLLAQPDSGE RECA_STRPZ 107 107 -
DAEHALDPTYSAALGVDINNLLVAQPDTGE A3IPB2_9CHRO 97 97 -
DAEHAFDQTYAKKLGLDIGSLLVSQPESGE B3ENK1_CHLPB 106 106 -
DAEHALDPVYAASLGVDVENLLVSQPDTGE RECA_PROM4 112 112 -
DAEHAFDKTYAEKLGIDTTNLLISQPDNGE RECA_CYTH3 102 102 -
DAEHALDPHYAASLGVDVENLLVSQPDTGE Q05ZF3_9SYNE 107 107 -
DAEHALDPHYAASLGVDVENLLVSQPDTGE RECA_SYNS9 107 107 -
DAENALDPQYATALGVQINDLLLSQPDTGE RECA_LACF3 93 93 -
DAEHALDPTYSGALGVDIDNLLVAQPDTGE Q4BUQ0_CROWT 97 97 -
DAEHALDPSYARKLGALDELLISEPDAGEQ RECA_AQUMA 92 92 -
DAEHAFDRFYAAHLGVDVENLYISQPDNGE RECA_PRERU 103 103 -
DAEHALDPVYAAALGVDVSELLVCQPDSGE A8ZKA1_ACAM1 97 97 -
DAEHALDVSYARRLGVNTDELLISQPDYGE B8J369_DESDE 101 101 -
DAEHALDPVYAAALGVDVSELLVCQPDSGE A8ZP31_ACAM1 97 97 -
DAEHALDPNYAKALGVDIDNLVLSQPDTGE RECA_ACHLI 94 94 -
DAEHALDVNYARRLGVNTDELLISQPDYGE B6WXJ7_9DELT 101 101 -
DAENALDVKYAEALGVKKDELLLSQPDTGE Q03YM4_LEUMM 106 106 -
DAENAMDPKYAAALGVNIDELLLSQPDTGE B5QRW4_LACRH 94 94 -
DAEHALDPTYSAALGVDIENLLVAQPDNGE RECA_SYNP2 97 97 -
DAEHALDPNYAKALGVDLDNLVLSQPDTGE RECA_ACHLA 94 94 -
DAEHAIDPVYAQNLGVNIDELILSQPDSGE B1C2D5_9FIRM 103 103 -
DAEHALDPAYAAALGVNIDELLLSQPDSGE RECA_STRTR 107 107 -
DAEHALDPYYAANLGVDVENLLISQPDTGE B4WLQ8_9SYNE 96 96 -
DAENALDVKYAEALGVQKDELLLSQPDTGE B1MZY7_LEUCK 107 107 -
DAEHALDVKYAKRLGVNTDELLISQPDYGE B7DL17_DESSA 100 100 -
DAEHALDPVYAKALGVDIDELLISQPDYGE Q7P621_FUSNV 108 108 -
DAEHALDPTYSEDLGVDINNLLVAQPDTGE A8YJ75_MICAE 97 97 -
DAEHALDPTYSEDLGVDINNLLVAQPDTGE B0JV95_MICAN 97 97 -
DAEHALDVMYARKLGVNTDNLVISQPDTGE RECA_WOLTR 100 100 -
DAENALDPEYAKALGVNIDELLLSQPDYGE RECA1_LACLA 108 108 -
DAEHALDTLYARKLGVSVGDLIVSQPDTGE Q2GIE7_ANAPZ 96 96 -
DAEHAFDRTYAEKLGVNVDNLWIAQPDNGE RECA_PORG3 102 102 -
DAEHAFDRTYAEKLGVNVDNLWIAQPDNGE RECA_PORGI 102 102 -
DAEHALDVGYAKNLGVDVDNLLVSQPDYGE RECA_SULDN 93 93 -
DAEHALDPVYAKNLGVDLKSLLISQPDHGE B7REZ5_9THEM 96 96 -
DAEHALDPVYAKNLGVDLKSLLISQPDHGE RECA_THESQ 96 96 -
DAEHALDPVYAKNLGVDLKSLLISQPDHGE RECA_THEP1 96 96 -
DAEHALDPVYAKNLGVDLKSLLISQPDHGE RECA_THEMA 96 96 -
DAEHAFDRTYAKNLNIDIDNLIISQPDHGE Q1VQU1_9FLAO 99 99 -
DAEHALDPTYSEVLGVDIHNLLVAQPDTGE B7KLB5_CYAP7 97 97 -
DAEHALDPVYANSIGVDVDELFVSQPDSGE B2KEX6_ELUMP 93 93 -
DAEHALDPSWAKKLGVELETLLVSQPSSGE A3ZNU6_9PLAN 131 131 -
DAEHALDPGFASKLGVNVKRLLISQPDTGE RECA_ACIFA 95 95 -
DAEHALDPVYAKNLGVDLKSLLISQPDHGE B9K7N7_THENE 96 96 -
DAEHALDPVYAQNLGVNVNDLLIAQPDYGE B7ID28_THEAB 97 97 -
DAEHAFDKNYAEKLGIDTENLYIAQPDNGE B3ETT2_AMOA5 95 95 -
DAEHAIDPVYAQNLGVNIDELILSQPDSGE B0N0K4_9FIRM 106 106 -
DAEHAFDQAYARKLGVDINALLVSQPESGE B4S4R7_PROA2 105 105 -
DAEHALDPLYAKKLGVDVQELLVSQPDTGE A6ZIK1_THEAQ 93 93 -
DAEHALDPKYAKNLGVDVENLYISQPDYGE A8UQJ4_9AQUI 101 101 -
DAEHALDPTYSSALGVDIANLLVSQPDSGE B4VLI9_9CYAN 98 98 -
DAEHALDPLYAKKLGVDVQELLVSQPDTGE B7A501_THEAQ 93 93 -
DAEHALDPLYAKKLGVDVQELLVSQPDTGE RECA_THEAQ 93 93 -
DAENALDPEYAKALGVNIDELLLSQPDYGE RECA_LACLC 108 108 -
DAENALDPEYAKALGVNIDELLLSQPDYGE RECA_LACLS 108 108 -
DAENALDPEYAKALGVNIDELLLSQPDYGE RECA_LACLM 108 108 -
DAEHAFDVTYARSVGVDIDRLLVSQPDNGE A9G764_SORC5 97 97 -
DAEHALDINYARRLGVKTDEMLISQPDYGE RECA_DESDG 101 101 -
DAENSLDAKYAQALGVNVDDLLLSQPDTGE RECA_OENOB 93 93 -
DAEHALDPTYAAALRVDIQNLLVAQPDTGE RECA_THEEB 100 100 -
DAEHAFDKTYAEKLGINTENLLISQPDNGE A1ZUC7_9SPHI 97 97 -
DAEHALDPKYAKKLGVDVDNLYISQPDYGE RECA_AQUPY 99 99 -
DAEHALDPSYAALIGVNVDDLMISQPDCGE B5LMU1_9CHLA 95 95 -
DAEHALDPGYAKKLGVNLDDLLVSQPDCGE B2ERF9_9BACT 139 139 -
DAEHALDIAYAKRLGVKTDELIISQPDHGE Q1MP41_LAWIP 100 100 -
DAENAIDPNYAKNLGVNIDELILSQPDSGE A8RC56_9FIRM 100 100 -
DAEHALDPKYAKKLGVDVENLYISQPDYGE O67905 96 96 -
DAEHALDPSYAGKIGINIDDLMISQPDSGE Q6M9N0_PARUW 100 100 -
DAEHAFDPSWAKKLGVELDSLLVSQPSSGE RECA_RHOBA 116 116 -
DAEHALDPLYAQRLGVQVEDLLVSQPDTGE RECA_THET2 93 93 -
DAEHALDPLYAQRLGVQVEDLLVSQPDTGE RECA_THET8 93 93 -
DAEHALDPVYAKALGVDLKTLLISQPDYGE A8F8W0_THELT 98 98 -
DVEHALDPKYARKLGVNVDDLLVSQPDSGE B5JPT4_9BACT 103 103 -
DAEHALDPLYAQRLGVQVEDLLVSQPDTGE RECA_THETH 93 93 -
DAEHALDPVWAKKLGVNISELLVSQPTYGE A6CF28_9PLAN 110 110 -
DVEHALDPQYAARLGVNLDDLLVSQPSSGE B2UPW5_AKKM8 106 106 -
DAEHALDPNYAALIGANINDLMISQPDCGE RECA_CHLMU 95 95 -
DAEHALDPVYARSLGVNTDELLVSQPDNGE B1NEZ0_9DEIO 106 106 -
DAEHALDPVYARSLGVNTDELLVSQPDNGE RECA_DEIGD 106 106 -
DAEHALDPNYAALIGANINDLMISQPDCGE RECA_CHLT2 95 95 -
DAEHALDPNYAALIGANINDLMISQPDCGE RECA_CHLTR 95 95 -
DAEHALDPNYAALIGANINDLMISQPDCGE RECA_CHLTB 95 95 -
DAEHALDPNYAALIGANINDLMISQPDCGE RECA_CHLTA 95 95 -
DAEHALDPSYASLIGVNIDDLMISQPDCGE RECA_CHLPN 95 95 -
DAEHALDPVYAKNLGVDVENLLIAQPDYGE RECA_THEM4 96 96 -
DAEHALDISYARALGVDVDNLLISQPDYGE B6YNU1_9BACT 98 98 -
DAENAIDPVYAKNLGVNIDELILSQPDSGE B7C8F6_9FIRM 98 98 -
DAEHALDVEYARKLGVDVDKLIVSQPDYGE RECA_PETMO 100 100 -
DAEHSLDPEYAAALGVDVDNLVVVQPDTGE B5A778_9CAUD 86 86 -
DAEHALDVQYAQALGVDPDELLVSQPDCGE A6FZ21_9DELT 117 117 -
DVEHALDPVYAKSLGVDIDHLIVSQPDTGE B0MMT9_9FIRM 112 112 -
DAEHALDLNYAKNLGIDLSELLVSQPDYGE A7HMK5_FERNB 95 95 -
DAEHALDPAYAAALGVDIDSLLVSQPDSGE B5YLR6_THAPS 156 156 -
DAEHALDPSYASLIGANIHDLMISQPDCGE RECA_CHLAB 95 95 -
DAEHALDPGYASLIGANINDLMISQPDCGE RECA_CHLCV 95 95 -
DAEHALDPGYASLIGANINDLMISQPDCGE RECA_CHLFF 95 95 -
DAEHAFDPNYAKTIGVDIENLLVSQPEYGE Q2RLQ9_MOOTA 93 93 -
DAEHAIDPGYAKKIGVDIDNLLISQPNCGE A6PMM6_9BACT 102 102 -
DVEHALDPIYAKHLGVITDDLLLSQPDGGE B0VJL1_9BACT 94 94 -
DAENAMDPKYAAELGVNIDDLLLSQPNSGE B3WAZ9_LACCB 107 107 -
DAENAMDPKYAAELGVNIDDLLLSQPNSGE Q034K4_LACC3 107 107 -
DAENAMDPKYAAELGVNIDDLLLSQPNSGE B5QRV4_LACRH 107 107 -
DAEHALDPVYARALGVNTDELLVSQPDNGE RECA_DEIRA 106 106 -
DAEHAFDPKYAKAIGVNLDELIISQPDYGE B2V7T2_SULSY 98 98 -
DAEHALDPQYAKDLGVSVGDLWISQPDTGE RECA_TREPA 107 107 -
DAEHALDPQYAKDLGVSVGDLWISQPDTGE RECA_TREPS 107 107 -
DVEHALDPQYCRKLGVNMNELLISQPDSGE B3DW93_METI4 69 69 -
DAEHALDPAYAKALGVNIDELWISQPDTGE RECA_BORHD 107 107 -
DAEHALDPAYAKALGVNIDELWISQPDTGE RECA_BORHE 107 107 -
DAEHSLDPEYAKALGVDLDNLVVVQPDTGE B5A674_9CAUD 86 86 -
DAEHSLDPEYAKALGVDLDNLVVVQPDTGE Q857P7_9CAUD 86 86 -
DAEHSLDPEYAKALGVDLDNLVVVQPDTGE Q1A0V6_9CAUD 86 86 -
DAEHALDPVYARALGVNINELWLSQPDTGE RECA_BORDL 107 107 -
DAEHALDPVYARKLGVDVENLYISQPDYGE B5Y8R3_COPPD 101 101 -
DAEHALDPSLAEAIGVKTENLLLAQPDCGE B8LRS8_PICSI 184 184 -
DAEHALDPVYAKALGVNVSELWLSQPDTGE B7XTL8_BORGA 109 109 -
DAEHALDPVYAKALGVNVAELWLSQPDTGE B7J164_BORBZ 109 109 -
DAEHALDPVYAKALGVNVAELWLSQPDTGE RECA_BORBU 109 109 -
DAEHALDPVYAKALGVNVAELWLSQPDTGE B9AAC3_BORBU 109 109 -
DAEHALDPVYAKALGVNVAELWLSQPDTGE RECA_BORAP 109 109 -
DVEHALDPKYSRIVGVNLDDLLVSQPDSGE A7CVA2_9BACT 134 134 -
DAEHALDPKYAVKLGVNLDAMYISQPDYGE B4U5L7_HYDS0 94 94 -
DVEHALDPKYARVVGVNLDDLLVSQPDSGE B1ZWP7_OPITP 106 106 -
DAEHALDPVYAKALGVNVSELWLSQPDTGE B7XUE1_BORGA 98 98 -
DAEHAFDPAYSKALGVDVENLIVCQPDNGE RECA_ARATH 170 170 -
DAEHALNPVYAKALGVNVSELWLSQPDTGE RECA_BORGA 109 109 -
DAEHAFDPAYSKALGVDIENLIVCQPDNGE B8AN40_ORYSI 175 175 -
DAEHAFDPAYSKALGVDIENLIVCQPDNGE Q10G85_ORYSJ 157 157 -
DAEHAFDPAYSKALGVDIENLIVCQPDNGE B9F9W5_ORYSJ 175 175 -
DAEHALDMQFAEGIGVNTKDLLFVQPDYAE A4PHN2_PHYPA 166 166 -
DAEHAFDPAYSKALGVDVENLIVCQPDNGE B9SVD4_RICCO 80 80 -
DAEHAFDPEYSQRLGLNVDDVIVCQPETGE A4S409_OSTLU 97 97 -
DAEHAFDPAYSKALGVDIENLIVCQPDNGE B6T788_MAIZE 153 153 -
DTEHALDPQYARMIGVNTQDLLVSQPDCGE A6DUF6_9BACT 99 99 -
DAEHAFDPEYSARLGLNLDDVIVCQPETGE Q00ZP1_OSTTA 124 124 -
DVEHSIDPVYAKNLGIDIDNLLISQPDSGE RECA_MYCPU 101 101 -
DAEHSIDPNYAKNLGVNIDNLILSQPDSGE RECA_MYCMO 89 89 -
DAEHSIDPQYAKNLGIDIDNLILSQPDSGE RECA_MYCH2 94 94 -
DAEHSIDPQYAKNLGIDIDNLILSQPDSGE RECA_MYCHJ 94 94 -
DAEHSIDPQYAKNLGIDIDNLILSQPDSGE RECA_MYCH7 94 94 -
DAEHCFDPYYSKALGVDVESLIVCQPDNGE A4PHN3_PHYPA 187 187 -
DAEHAIDPLYARNLGIDLNTLILSQPDSGE A5IYZ1_MYCAP 100 100 -
DAEHSLDLNYAKKIGVDINSLLVSQPSYGE RECA_MESFL 97 97 -
DAEHALDPKYAQAIGVNIDELVLSQPDSGE B3R0F8_APPPP 102 102 -
DAEHSIDPQYAANIGVDIDNLILSQPDSGE Q4A5K2_MYCS5 91 91 -
DAEHSLDPKYCHNLGIDTNKLLVSQPDNGE RECA_MYCMS 108 108 -
DAEHSLDPKYCHNLGIDTNKLLVSQPDNGE Q2SRU1_MYCCT 91 91 -
DAEHSIDPNYAKNVGVDIDNLILSQPDSGE B3PM51_MYCA5 96 96 -
DVEHAFDRTYAERLGINLNNFWYAQPMTGE A8I670_CHLRE 149 149 -
DAEHSLEPKYCQTLGIDTNKLLVSQPDNGE RECA_MYCMY 109 109 -
DAECSIDSKYLSHLGIDPTKLLVATPEYGE RECA_MYCPE 91 91 -
DLEGSFDINYAKSLKVDLTKLIITQPQTGE B1RUM9_UREPA 93 93 -
DLEGSFDINYAKSLKVDLTKLIITQPQTGE RECA_UREPA 93 93 -
DLEGSFDINYAKSLKVDLTKLIITQPQTGE RECA_UREP2 93 93 -
DLEGSFDINYAKSLKVDLTKLIITQPQTGE B2D8D9_UREPA 93 93 -
DLEGSFDINYAKSLKVDLTKLIITQPQTGE B1RW17_UREPA 93 93 -
IDAEFFNFNYAKTIGVDCNKMLISHPDSGE Q9LA65_PEWBP 94 94 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE B1RXB9_UREUR 93 93 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE RECA_UREU1 93 93 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE B5BMD7_UREUR 93 93 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE B3XV19_UREUR 93 93 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE B3XSE0_UREUR 93 93 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE B2NH97_UREUR 93 93 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE B2NFD6_UREUR 93 93 -
DLEGSFDLNYAKSLKVDLTKLIITQPQTGE B2D9Z3_UREUR 93 93 -
DAEHALDLRYVKRLGIDLTKLIIARPDYGE Q8RP56_MYCGA 113 113 -
DAENAMDPSLAESIGVNTEELLISRPSSAE RECAM_ARATH 151 151 -
DAEGALDLSYAKAIGIDLGKLLVAHPKHGE RECA_MYCPN 94 94 -

Motif 2 width=30
Element Seqn Id St Int Rpt
IADTLVRSGAVDVLVIDSVAALTPKAELEG RECA_PARL1 138 4 -
IADMLVRSGAVDVVVVDSVAALTPKAEIEG B8GQV3_9GAMM 128 4 -
IADMLVRSGSVDVVVVDSVAALTPKAEIEG RECA_METFK 128 4 -
ITDTLVRSNAVDILVVDSVAALVPRAEIEG Q2N9K3_ERYLH 138 4 -
ITDTLVRSNAVDVLVVDSVAALVPRAEIEG A3WBC0_9SPHN 138 4 -
ITDTLVRSNAIDVLVVDSVAALVPRAEIEG Q2G8V4_NOVAD 140 4 -
IADTLVRSGAIDVLVIDSVAALTPKAELEG A3VUD5_9PROT 137 4 -
IVDTLVRSNAIDVLVVDSVAALVPRAEIEG Q1GSD4_SPHAL 141 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG A5VQX5_BRUO2 202 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_BRUSU 139 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_BRUME 139 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_BRUC2 139 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_BRUAB 139 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_BRUA2 139 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_BRUA1 139 4 -
ITDTLVRSNAIDILVVDSVAALVPRAEIEG A5P749_9SPHN 127 4 -
IADMLVRSGSVDVVVVDSVAALTPKAEIEG Q3SGU3_THIDA 148 4 -
ITDMLVRSGAVDVVVVDSVAALTPKAEIEG RECA_CHRVI 128 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_OCHA4 139 4 -
IADMLVRSGSVDIIVVDSVAALTPRAEIEG RECA_DECAR 128 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_BRUSI 139 4 -
IADTLVRSGAIDVLVIDSVAALTPKAELEG B6R0D5_9RHOB 138 4 -
IADMLVRSGSVDIVVVDSVAALTPRAEIEG RECA_METCL 128 4 -
IAEALVRSGAVDVIVIDSVAALVPKAEIEG B3KIK6_9BACI 102 4 -
IADMLVRSGSVDVVVVDSVAALTPKAEIEG RECA_METFL 128 4 -
IVDSLVRSGAVDLIVVDSVAALTPKAEIEG B7YNW3_VARPD 140 4 -
IVDTLVRSNAIDILVIDSVAALVPRAEIEG Q1NDI6_9SPHN 167 4 -
IAEALVRSGAIDVIVIDSVAALVPKAEIDG A3DEA3_CLOTH 126 4 -
IAEALVRSGAIDVIVIDSVAALVPKAEIDG B4BH94_CLOTM 126 4 -
ITDTLVRSGAVDVLVVDSVAALTPRAEIEG B0JBR8_RHILT 139 4 -
ITDTLVRSGAVDVLVVDSVAALTPRAEIEG RECA_RHILW 139 4 -
ITDTLVRSGAVDVLVVDSVAALTPRAEIEG RECA_RHIL3 139 4 -
IADMLVRSGAVDLIVIDSVAALTPKAEIEG B7J7A9_ACIF2 128 4 -
IADMLVRSGAVDLIVIDSVAALTPKAEIEG RECA_ACIF5 128 4 -
ITDTLVRSGAVDVLVVDSVAALTPRAEIEG RECA_RHIE6 139 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG A8TPM0_9PROT 138 4 -
IADTLVRSNAIDVLVIDSVAALVPRAEIEG A5V3L4_SPHWW 141 4 -
IADTLVRSGAVDLVVIDSVAALTPRAEIEG Q0BYM2_HYPNA 131 4 -
ICDTLVRSGAVDVLVVDSVAALVPKAELEG RECA_BRAJA 139 4 -
ICDALVRSGAVDLIVVDSVAALTPKAEIEG RECA_HERSE 135 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG B9JFS7_9RHIZ 139 4 -
IADTLVRSGAIDVLVIDSVAALTPKAELEG A0NP88_9RHOB 125 4 -
IADTLVRSGAIDVLVIDSVAALTPRAELEG A3UDY2_9RHOB 138 4 -
ITDTLVRSGAVDVLVIDSVAALTPRAEIEG B2IHX1_BEII9 126 4 -
ITEALVRSGAIDVIVVDSVAALVPKAEIDG B8I7D2_CLOCE 126 4 -
IADALVRSGSIDMIVIDSVAALVPKAEIEG B2SYF4_BURPP 138 4 -
ITDTLVRSGAIDILVIDSVAALVPRAEIEG RECA_RHIME 126 4 -
IAEALVRSGAIDVIVIDSVAALVPKAEIEG RECA_BACHD 126 4 -
ICDMLVRSGAVDVVVVDSVAALTPKAEIEG RECA_PSEA6 127 4 -
IAEALVRSGAIDVIVVDSVAALVPKAEIEG A6TRJ2_ALKMQ 125 4 -
ICDTLVRSGAVDVLVVDSVAALVPKAELEG A4YXR0_BRASO 139 4 -
ICDTLVRSGAVDVIVVDSVAALTPRAEIEG RECA_MESSB 139 4 -
ITDALVRSGSIDLIVIDSVAALVPKAEIEG RECA_RALME 137 4 -
IADTLVRSGAVDVLIIDSVAALVPRAELEG A3WVK2_9BRAD 139 4 -
IADTLVRSGAVDVLIIDSVAALVPRAELEG RECA_NITWN 139 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG A4IMG9_GEOTN 102 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG B4BIW4_9BACI 127 4 -
IADTLVRSGAIDVLIVDSVAALVPRAELEG Q13AC3_RHOPS 140 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG B7GJN3_ANOFW 172 4 -
ICDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_RHILO 139 4 -
IADTLVRSGAIDVLVIDSVAALVPKAELEG RECA_RHORT 139 4 -
ITDTLVRSGRVDVLVVDSVAALTPRAEIEG RECA_RHILV 126 4 -
ICDMLVRSGAVDVVIVDSVAALTPKAEIEG RECA_ALTMD 127 4 -
ITDTLVRSGAIDVLVVDSVAALVPRAEIEG RECA_SINMW 139 4 -
IADMLVRSSAVDVVVIDSVAALTPKAEIEG B5JVA0_9GAMM 127 4 -
ITDSLVRSGAVDIVIVDSVAALTPKAEIEG RECA_THICR 128 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG B8IP29_METNO 141 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_METS4 141 4 -
ICDMLVRSGAVGVVVVDSVAALTPKAEIEG A1T002_PSYIN 130 4 -
ITDMLVRSGSVDVVVVDSVAALTPRAEIEG B6BWK4_9PROT 128 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG B7QSS1_9RHOB 139 4 -
ITDTLVRSGAVDVLVVDSVAALTPRAEIEG RECA_RHIEC 139 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG A2UZ65_SHEPU 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHESW 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEPC 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEB9 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEB8 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEB5 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG B8E8U2_9GAMM 129 4 -
ITDTLVRSGAVDVLVVDSVAALTPRAEIEG RECA_RHILP 139 4 -
IADTLVRSGAVDVLIIDSVAALVPRAELEG RECA_NITHX 139 4 -
IAEALVRSGAIDILVIDSVAALVPKAEIEG Q2B1K9_9BACI 117 4 -
IADTLVRSGAIDVLIVDSVAALVPRAELEG B3QI72_RHOPT 140 4 -
IADTLVRSGAIDVLIVDSVAALVPRAELEG RECA_RHOPA 126 4 -
IVDTLVRSGAVDIVVVDSVAALTPRAEIEG B4WEL0_9CAUL 139 4 -
IAEALVRSGAVDIIVVDSVAALVPKAEIEG A8MFC2_ALKOO 125 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG Q2T0V0_BURTA 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG A4JHK1_BURVG 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG RECA_BURS3 128 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG RECA_BURCJ 128 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG RECA_BURCE 128 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG Q0BC68_BURCM 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG B1YVY9_BURA4 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG B1T7P6_9BURK 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG B1FQP9_9BURK 137 4 -
ITDTLVRSGAVDVLVIDSVAALTPRAEIEG RECA_AGRTU 139 4 -
IADALVRSGAIDIIVVDSVAALVPKAEIEG A1HUE5_9FIRM 126 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG RECA_AZOLI 139 4 -
ITDTLVRSGAVDVLVIDSVAALTPRAEIEG B8ETR1_METSI 139 4 -
IADALVRSGSIDMIVIDSVAALVPKAEIEG Q13UH6_BURXL 138 4 -
IADALVRSGSIDMIVIDSVAALVPKAEIEG Q842H8_9BURK 138 4 -
IADALVRSGSIDMIVIDSVAALVPKAEIEG B1G226_9BURK 138 4 -
IVDTLVRSGAVSMIVVDSVAALTPKSELEG A6FSR2_9RHOB 140 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A1V6W5_BURMS 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG RECA_BURPS 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG RECA_BURMA 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG RECA_BURM1 128 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG Q3JVL9_BURP1 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG B9CCE0_9BURK 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG B9BTL7_9BURK 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG B9B3Z8_9BURK 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG B7CIU0_BURPS 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG B2H414_BURPS 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG B1HFF1_BURPS 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A9K5W0_BURMA 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A8KKV8_BURPS 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A8E9V2_BURPS 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A5XX15_BURMA 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A5TR11_BURMA 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A5JC36_BURMA 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A3NRX4_BURP0 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A3N690_BURP6 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A3MH63_BURM7 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG A2W7P8_9BURK 137 4 -
IVDALVRSGSIDMIVIDSVAALVPKAEIEG A2S8U6_BURM9 137 4 -
ITDALVRSGSIDLIVIDSVAALVPKAEIEG RECA_RALEJ 137 4 -
IADALVRSGSIDMIVIDSVAALVPKAEIEG B5WK23_9BURK 138 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG A0KA75_BURCH 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG Q1BTW3_BURCA 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG B1JY17_BURCC 137 4 -
ITDALVRSGSIDMIVIDSVAALVPKAEIEG A2VVQ7_9BURK 137 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG Q1YEB7_MOBAS 139 4 -
ITDMLVRSGAVDVVVVDSVAALTPKAEIEG RECA_ALHEH 129 4 -
IVDTLVRSGAVSMVVVDSVAALTPKSELEG A3SNY5_9RHOB 132 4 -
IAETLVRSGAIDVLVIDSVAALVPKAEIEG B3E9Z2_GEOLS 127 4 -
IVDTLVRSGAVSLVVVDSVAALTPKAEIEG RECA_RHOCA 140 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG A4VJP2_PSEU5 102 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG Q0FZI3_9RHIZ 139 4 -
IADTLVRSGAVDVLIVDSVAALVPRAELEG Q07R91_RHOP5 139 4 -
IVDSLVRSGAVDLIVVDSVAALTPKAEIEG A1WCY0_ACISJ 139 4 -
IVDSLVRSGAVDLIVVDSVAALTPKAEIEG B9MHR9_9BURK 139 4 -
IVDTLVRSGAVNMVVVDSVAALTPKSELEG A3VJG5_9RHOB 143 4 -
IAEALVRSGAIDIIVIDSVAALVPKAEIEG B1HR36_LYSSC 102 4 -
IAEALVRSGAVDIIVVDSVAALVPKAEIEG Q8GJ70_BACME 126 4 -
IADTLVRSGAVDVLIVDSVAALVPRAELEG B6JBM2_OLICO 139 4 -
ITDALVRSGSIDLIVIDSVAALVPKAEIEG RECA_RALEH 137 4 -
IAEALVRSGALDIIVIDSVAALVPKAEIEG RECA_BACSK 126 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG B6BE26_9RHOB 138 4 -
ITDALVRSGSIDLIVIDSVAALVPKAEIEG RECA_RALEU 137 4 -
IVDTLVRSGAVSLVVVDSVAALTPKSELEG A3V9G1_9RHOB 140 4 -
IADMLIRSGALDIIVIDSVAALVPRAEIEG A3TMD7_9MICO 135 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG A4BCJ0_9GAMM 132 4 -
IADALVRSGSVDLIVIDSVAALVPKAEIEG A3RQ47_RALSO 136 4 -
IADALVRSGSVDLIVIDSVAALVPKAEIEG B5SGP7_RALSO 136 4 -
IADALVRSGSVDLIVIDSVAALVPKAEIEG B5S8Q7_RALSO 136 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG B1BG38_CLOPE 130 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG RECA_CLOPE 130 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG RECA_CLOP1 130 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG B1RQ41_CLOPE 130 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG B1RIJ5_CLOPE 130 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG B1RAI9_CLOPE 130 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG B1BWW2_CLOPE 130 4 -
IVDSLVRSGAVDLIVVDSVAALTPKAEIEG A1WET8_VEREI 141 4 -
IADALVRSGSIDLIVIDSVAALVPKAEIEG B1XRZ6_POLNS 144 4 -
IAEALVRSGAVDIIVVDSVAALVPQKEIEG Q8GJ73_BACME 126 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG RECA_METRJ 141 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SHEON 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SHESR 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SHESM 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SHESA 129 4 -
IVDTLVRSGAVNMIVVDSVAALTPKSELEG B6AYP7_9RHOB 132 4 -
IADMLVRSGAVDLIVIDSVAALTPKAEIEG RECA_THIFE 128 4 -
ITDALVRSGSVDLIVIDSVAALVPKAEIEG RECA_BORPD 136 4 -
IADTLVRSGAVDVLIVDSVAALVPRAELEG Q218Q7_RHOPB 140 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEDO 129 4 -
IAEALVRSGAIDVLVVDSVAALVPKAEIEG RECA_CLOB8 130 4 -
ICEALVRSGAIDVIIIDSVAALVPRAEIEG B8G068_DESHD 129 4 -
ICEALVRSGAIDVIIIDSVAALVPRAEIEG Q24W60_DESHY 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEFN 129 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG A9W5Y7_METEP 144 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG B7KPS7_METC4 144 4 -
ITDTLVRSGAIDVLVVDSVAALTPRAEIEG B1ZC93_METPB 144 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SERMA 129 4 -
IADMLVRSGSIDIMVIDSVAALTPKAEIEG Q3R742_XYLFA 127 4 -
IADMLVRSGSIDIMVIDSVAALTPKAEIEG RECA_XYLFM 127 4 -
IADMLVRSGSIDIMVIDSVAALTPKAEIEG Q3RE83_XYLFA 127 4 -
IADTLVRSGAIDVLVVDSVAALTPRAELDG A7IMQ9_XANP2 139 4 -
IVDSLTRSGAVDLIVVDSVAALTPKAELEG Q122H4_POLSJ 146 4 -
ICEALVRSGAIDVIVVDSVAALVPKAEIEG RECA_CLONN 127 4 -
ITDTLVRSGAVSLVVVDSVAALTPKSELEG Q2C9X3_9RHOB 141 4 -
ICDTLVRSGAVDVLVVDSVAALVPKAELEG A5EMM4_BRASB 139 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG A9E4G3_9RHOB 140 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG B7V8D1_PSEA8 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEAE 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEAB 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEA7 127 4 -
IVDSLTRSGAVDLIVIDSVAALTPKAELEG A1VUC3_POLNA 138 4 -
IADTLVRSGAIDILVIDSVAALTPRAELEG Q0AQY8_MARMM 139 4 -
ITEALVRSGAIDVLVVDSVAALVPRAEIEG RECA_CLOPS 130 4 -
ITDTLVRSGAVDIVVVDSVAALTPKAEIEG B8H3I7_CAUCR 139 4 -
ITDTLVRSGAVDIVVVDSVAALTPKAEIEG RECA_CAUCR 139 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG RECA_ACICJ 126 4 -
IAEALVRSGAVDIVVIDSVAALVPKAEIEG RECA_BACLD 126 4 -
IAEALVRSGAVDIVVIDSVAALVPKAEIEG RECA_BACLI 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG B1DLF1_9BACL 126 4 -
IADALVRSGSIDLIVIDSVAALVPRAEIEG A4SZY2_POLSQ 144 4 -
ITDMLVRSAAVDVVIIDSVAALTPKAEIEG RECA_LEGPN 128 4 -
ITDMLVRSAAVDVVIIDSVAALTPKAEIEG RECA_LEGPL 128 4 -
ITDMLVRSAAVDVVIIDSVAALTPKAEIEG RECA_LEGPH 128 4 -
ITDMLVRSAAVDVVIIDSVAALTPKAEIEG RECA_LEGPC 128 4 -
ITDMLVRSAAVDVVIIDSVAALTPKAEIEG RECA_LEGPA 128 4 -
ITDMLVRSAAVDVVIIDSVAALTPKAEIEG B2C321_LEGPN 128 4 -
IVDALVRSGSVDLIVVDSVAALTPKAELEG B1XY03_LEPCP 136 4 -
ICDMLVRSGAVDVIIIDSVAALTPKAEIEG B9DEP2_9GAMM 127 4 -
ITDTLVRSGAVNMVVVDSVAALTPKSELEG B9NRH1_9RHOB 137 4 -
IADTLVRSGAVDVLVVDSVAALVPRAELEG RECA_GLUOX 125 4 -
ICDSLVRSGAVDLIVIDSVAALTPKAEIEG B7X245_COMTE 137 4 -
IAEALVRSGAIDIIVIDSVAALVPKAEIEG RECA_BACCN 126 4 -
IADMLVRSGSIDIMVIDSVAALTPRAEIEG RECA_XYLFA 127 4 -
IADTLVRSGAIDVLVVDSVAALTPRAELDG A8ICX1_AZOC5 139 4 -
ICDMLVRSGAVDVVIIDSVAALTPKAEIEG A4C6Y7_9GAMM 127 4 -
IAEALVRSGAIDVIIVDSVAALVPKAEIEG RECA_CLOBA 130 4 -
IADMLVRSGSVDILVIDSVAALTPKAEIEG RECA_STRMK 127 4 -
ITDALVRSGSIDLIIIDSVAALVPKAEIEG RECA_CUPTR 137 4 -
ICDALSRSGAVDVIVVDSVAALTPKAEIEG RECA_PROMI 129 4 -
ICDALSRSGAVDVIVVDSVAALTPKAEIEG RECA_PROMH 129 4 -
ICDMLVRSSAVDVVIIDSVAALTPKAEIEG Q3IFN0_PSEHT 127 4 -
ITDTLVRSGAIDVLVIDSVAALTPKAEIEG B9JX56_AGRVI 139 4 -
IADVLVRSGGVDVVVIDSVAALTPKAELEG RECA_METCA 128 4 -
IADMLVRSGSVDILVIDSVAALTPKAEIEG B8L292_9GAMM 148 4 -
ITDALVRSGSVDLIVIDSVAALVPKAEIEG Q2KYE8_BORA1 135 4 -
ITDMLVRSNAIDVIVVDSVAALVPKAEIEG RECA_PSE14 127 4 -
ITDMLVRSNAIDVIVVDSVAALVPKAEIEG RECA_PSEU2 127 4 -
ITDMLVRSNAIDVIVVDSVAALVPKAEIEG RECA_PSESM 127 4 -
IVDMLVRSGALDLIVIDSVAALVPKAEIEG B5HF96_STRPR 128 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_ERWCT 129 4 -
IVDTLVRSGAVSMIVVDSVAALTPKSELEG A3VX42_9RHOB 140 4 -
IVDSLVRSGAVDLIVVDSVAALTPKAEIEG A1TW37_ACIAC 137 4 -
ITDTLVRSGALDVLVIDSVAALTPRAEIEG A9D6F1_9RHIZ 139 4 -
IAEALVRSGAVDIVVIDSVAALVPKAEIEG RECA_BACP2 126 4 -
IAEALVRSGAVDIVVIDSVAALVPKAEIEG B4ADR5_BACPU 126 4 -
ITETLVRSGAVNMVVVDSVAALTPKAELEG A3JSX3_9RHOB 139 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG A9EMD9_9RHOB 139 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG A9FNG9_9RHOB 139 4 -
IAEALVRSGAVDIVVVDSVAALVPKAEIEG Q659J5_BACAM 126 4 -
IAEALVRSGAVDIVVVDSVAALVPKAEIEG RECA_BACSU 125 4 -
IAEALVRSGAVDIVVVDSVAALVPKAEIEG RECA_BACA2 126 4 -
IAEALVRSGAVDIVVVDSVAALVPKAEIEG Q8GJG2_BACAM 126 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A6XC70_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALTY 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALTI 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALSV 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALPK 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALPB 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALPA 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALNS 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALHS 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALG2 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALEP 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALDC 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALCH 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SALA4 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5Q846_SALVI 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5PUL0_SALHA 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5PGV9_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5PA02_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5NNK4_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5NBF9_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5N4V4_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5MKA1_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5CBG8_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B5BYR3_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B4A2F6_SALNE 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3YID4_SALET 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A9MFY8_SALAR 134 4 -
IVDALVRSGSVDLIVVDSVAALTPKAELEG RECA_METPP 135 4 -
IVDSLVRSGAVDLIVVDSVAALTPKAELEG Q21RF6_RHOFD 162 4 -
IADMLVRSGSVDIVVVDSVAALTPKAEIEG RECA_XANC5 127 4 -
IAETLVRSGAIDVLVIDSVAALVPKAEIEG A5GDB6_GEOUR 127 4 -
IVDTLVRSGAVNLIVVDSVAALTPKSEIEG B9KKJ7_RHOSH 150 4 -
IVDTLVRSGAVNLIVVDSVAALTPKSEIEG RECA_RHOSH 126 4 -
IVDTLVRSGAVNLIVVDSVAALTPKSEIEG RECA_RHOS1 140 4 -
IAEMLVRSGAVDVLVIDSVAALVPKAEIEG RECA_GEOSL 128 4 -
ITETLVRSGAVDVLVVDSVAALTPRAEIDG RECA_BARHE 126 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SHELP 129 4 -
IADTLVRSGAVDVLVVDSVAALVPRAELEG RECA_MAGMM 139 4 -
IADTLVRSGAIDVLVIDSVAALTPKAELEG B9R0H5_9RHOB 138 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_KLEP7 129 4 -
IAEALVRSGAIDVIIVDSVAALVPKAEIEG RECA_CLOBB 130 4 -
ITDTLIRSNAVDILVVDSVAALTPRAEIEG RECA_ZYMMO 125 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG Q4IXX9_AZOVI 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_KLEP3 129 4 -
IVDMLTRSGAIDVIVVDSVAALTPKAEIEG RECA_COLP3 127 4 -
IADMLVRSGSIDIMVIDSVAALTPRAEIEG RECA_XYLF2 127 4 -
IADMLVRSGSIDIMVIDSVAALTPRAEIEG RECA_XYLFT 127 4 -
ITDALVRSGSVDLIVIDSVAALVPKAEIEG RECA_BORBR 136 4 -
ITDALVRSGSVDLIVIDSVAALVPKAEIEG RECA_BORPE 136 4 -
ITDALVRSGSVDLIVIDSVAALVPKAEIEG RECA_BORPA 136 4 -
ITETLVRSGAVDVVVIDSVAALVPRAEIEG B9KXK1_THERO 126 4 -
ITDMLVRSGAVDIIVVDSVAALTPKAEIEG A4BU37_9GAMM 130 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG RECA_STRAW 128 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG RECA_STRVL 128 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG RECA_STRLI 128 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG O50487 128 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG A3N1E7_ACTP2 144 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG B3GY31_ACTP7 144 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG B0BQ84_ACTPJ 144 4 -
ICDALSRSGAVDVIVVDSVAALTPKAEIEG RECA_ERWCA 129 4 -
ITDTLVRSGAVSMVIVDSVAALTPKSELEG A3TWS8_9RHOB 140 4 -
IAETLVRSGAIDVLVVDSVAALVPKAEIEG B3JUW6_9DELT 130 4 -
IAETLVRSGAIDVLVVDSVAALVPKAEIEG RECA_GEOBB 130 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG A4ERJ5_9RHOB 138 4 -
IAEMLVRSGAVDVLVIDSVAALVPKAEIEG RECA_GEOMG 128 4 -
ICDALARSGAVDVIIVDSVAALTPKAEIEG RECA_ERWT9 129 4 -
IADALVRSGSIDMIVIDSVAALVPKAEIEG B2JDB5_BURP8 138 4 -
ITDTLVRSNAVDVIVVDSVAALTPRAEIEG B4RHD9_PHEZH 139 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEP1 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEPU 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEPK 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEPG 127 4 -
IAEMLVRSGAIDVLVVDSVAALVPKAELEG Q1DCH8_MYXXD 131 4 -
IAEMLVRSGAIDVLVVDSVAALVPKAELEG REC2_MYXXA 131 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG A6BYJ2_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPY 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPS 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPP 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPN 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPG 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPB 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERPA 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERP3 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B0HV90_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B0HJM0_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B0H198_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B0GVR3_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B0GB33_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG A9ZXU8_YERPE 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG A9Z5H3_YERPE 129 4 -
ICDALSRSGAVDVIVVDSVAALTPKAEIEG RECA_XENBV 129 4 -
ICDMLVRSSAVDVVIVDSVAALTPKAEIEG A0XYZ7_9GAMM 127 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG B0QV50_HAEPR 144 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SERP5 129 4 -
IAEALVRSGAVDIIVVDSVAALVPKAEIEG RECA_OCEIH 126 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_CITK8 129 4 -
ITDTLVRSGAVNMVVVDSVAALTPKSELEG RECA_SILPO 132 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG RECA_AMYMD 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_PHOLL 129 4 -
IADMLVRSGSVDILVVDSVAALTPKAEIEG RECA_STRM5 127 4 -
ITDTLVRSGAVNMVVVDSVAALTPKSELEG A3SGP7_9RHOB 140 4 -
ITDTLVRSGAVNMVVVDSVAALTPKSELEG A3T116_9RHOB 132 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG RECA_RHOVI 126 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ENT38 129 4 -
IVDTLVRSGAVSLIVVDSVAALTPKSEIEG RECA_RHOS5 140 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B6A8B5_9ENTR 129 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG B8F639_HAEPR 144 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG Q308R5_STRAA 128 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG RECA_STRAM 128 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A1AEN9_ECOK1 134 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SHISS 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SHISO 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SHIFL 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SHIF8 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SHIDS 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SHIBS 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_SHIB3 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOUT 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOSE 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOLI 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOLC 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOL6 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOL5 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECOHS 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECO5E 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_ECO24 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B7UHB7_ECO27 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B7NSH9_ECO7I 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B7N6S9_ECOLU 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B7MKG8_ECO45 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B7M9D6_ECO8A 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B7LW30_ESCF3 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B7LEB1_ECO55 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B6ZWC2_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3XHH4_ECOLX 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3X0Z2_SHIDY 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3WLX1_ECOLX 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3ILR5_ECOLX 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3I8V5_ECOLX 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3HQ29_ECOLX 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3HDP6_ECOLX 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3BYJ2_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3BJ81_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3B4W2_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3ANH0_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B3A6T9_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B2PF74_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B2P7H8_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B2NRK8_ECO57 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B2N1H9_ECOLX 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B1LQ17_ECOSM 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B1EGX3_9ESCH 129 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEHH 129 4 -
ITDMLVRSNAIDVIVVDSVAALVPKAEIEG RECA_PSEFL 127 4 -
ITDMLVRSNAIDVIVVDSVAALVPKAEIEG RECA_PSETO 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEE4 127 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEPW 127 4 -
IVDTLVRSGAVSMIVVDSVAALTPKSELEG B5JZH2_9RHOB 139 4 -
IVDTLVRSGAVSLVVVDSVAALTPKSEIEG A1AZL5_PARDP 140 4 -
IAEALVRSGAIDIIVIDSVAALVPKAEIEG A3ICA9_9BACI 126 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG B1VXV8_STRGG 128 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG Q1GHA3_SILST 139 4 -
IAEALVRSNAIDIVVVDSVAALVPKAEIQG RECA_CLOTE 127 4 -
IADTLVRSGAVDVLVVDSVAALVPRAELEG RECA_ACEPO 131 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B8CJQ6_9GAMM 129 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG Q0BSC0_GRABC 132 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEPA 129 4 -
ICDMLVRSGAVDIVIVDSVAALTPKAEIEG RECA_IDILO 127 4 -
ICDALSRSGAVDVIIVDSVAALTPKAEIEG RECA_XENNE 129 4 -
IAEALVRSGAVDVIVVDSVAALVPKNELEG B7DS99_9BACL 126 4 -
ITEVLVRSGAIDVLVIDSVAALVPRAEIEG Q3A1W3_PELCD 129 4 -
IADALVRSGSVDLIVIDSVAALVPKAEIEG RECA_RALSO 136 4 -
ICDMLVRSNAVDVIIVDSVAALTPKAEIEG A3JHQ1_9ALTE 127 4 -
IADMLVRSGSIDVVVVDSVAALTPRAEIEG RECA_NITMU 128 4 -
ITDMLVRSGAVDLIVIDSVAALTPKAEIEG A9KG26_COXBN 127 4 -
ITDMLVRSGAVDLIVIDSVAALTPKAEIEG RECA_COXBU 127 4 -
ITDMLVRSGAVDLIVIDSVAALTPKAEIEG B6J042_COXB2 127 4 -
ITDMLVRSGAVDLIVIDSVAALTPKAEIEG A9ZH63_COXBU 127 4 -
ITDMLVRSGAVDLIVIDSVAALTPKAEIEG A9NCN5_COXBR 127 4 -
IADMLVRSGGVDVVVIDSVAALTPKAEIEG RECA_AZOSB 128 4 -
ITDMLVRSNAVDVIIVDSVAALTPKAEIEG Q2BQV7_9GAMM 127 4 -
IADALVRSGSVDLIVIDSVAALVPKAEIEG A7CFE0_BURPI 225 4 -
IADALVRSGSVDLIVIDSVAALVPKAEIEG B2UGD9_RALPJ 136 4 -
IADTLVRSGAIDVLIVDSVAALVPRAELEG Q2ITM5_RHOP2 141 4 -
IAEMLVRSGAIDVLVVDSVAALVPKAELEG Q08Y00_STIAU 131 4 -
IADMLVRSGAVDILVIDSVAALTPKAEIEG B8FL00_9DELT 129 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A1EPV0_VIBCH 185 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_VIBCH 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_VIBC3 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A6XXS5_VIBCH 185 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A6AEW1_VIBCH 185 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A6A6C3_VIBCH 185 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A3GQD3_VIBCH 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A3ENA6_VIBCH 185 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A3EGF8_VIBCH 185 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A2PUQ2_VIBCH 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A2PKZ0_VIBCH 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A2P8I1_VIBCH 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG A1F832_VIBCH 127 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG Q45ND1_MORCA 128 4 -
ITDTLVRSGAVSLVVVDSVAALTPKSELEG A3K228_9RHOB 132 4 -
ITETLVRSGAIDVLVIDSVAALVPKAEIEG B9M365_9DELT 127 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_YERE8 129 4 -
ITDTLVRSGAVDIVVIDSVAALTPKAEIEG RECA_CAUSK 139 4 -
ICDALVRSGAFDVIVVDSVAALTPKAEIEG RECA_DICNV 128 4 -
ITDTLVRSGAVSMVVVDSVAALTPRAELEG Q0FAQ7_9RHOB 139 4 -
IVDTLVRSGAVNMVVVDSVAALTPKSELEG B7RH74_9RHOB 140 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEST 127 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG A9M0G4_NEIM0 103 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG RECA_NEIMF 128 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG RECA_NEIGO 128 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG RECA_NEIG2 128 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG RECA_NEIG1 128 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG Q1KMW2_NEIME 128 4 -
IADMLVRSSSVDIVVIDSVAALTPKAEIEG RECA_XANOM 127 4 -
IADMLVRSSSVDIVVIDSVAALTPKAEIEG RECA_XANOR 127 4 -
IADMLVRSSSVDIVVIDSVAALTPKAEIEG RECA_XANOP 127 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHEWM 129 4 -
ICDALARSGAVDVLVVDSVAALTPKAEIEG RECA_ENTS8 129 4 -
ICDALVRSGGVDLIVIDSVAALTPRAEIEG RECA_HERAR 135 4 -
ICDMLVRSGAVDVVIVDSVAALTPKAEIEG A3WM74_9GAMM 127 4 -
IADMLVRSGALDIIVIDSVAALVPRAEIEG RECA_FRAAA 129 4 -
ICDALVRSGGVDLIVIDSVAALTPRAEIEG RECA_JANMA 135 4 -
IAEALVRSGAVDVIVVDSVAALVPRAEIEG A5D2R8_PELTS 127 4 -
IVDMLTRSGGVDIIVVDSVAALTPKAELEG Q0F3T6_9PROT 126 4 -
ITDMLVRSGAVDLIVIDSVAALTPKAEIEG B6J6Y7_COXB1 127 4 -
VADMLVRSGAVDVLVVDSVAALTPKAEIEG RECA_SACD2 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG B6FH76_9ENTR 134 4 -
ICEALVRSGAIDVVVVDSVAAMVTKAEIEG B0P6Q8_9FIRM 145 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG RECA_HAEDU 143 4 -
IADMLVRSSSVDIVVIDSVAALTPKAEIEG RECA_XANC8 127 4 -
IADMLVRSSSVDIVVIDSVAALTPKAEIEG RECA_XANCP 127 4 -
IADMLVRSSSVDIVVIDSVAALTPKAEIEG RECA_XANCB 127 4 -
IAEALVRSGAIDVIVVDSVAALVPKAEIEG RECA_CLOAB 127 4 -
ITDTLIRSNAVDILVVDSVAALTPRAEIEG Q8GF01_ZYMMO 140 4 -
IADMLVRSGGVEIVVIDSVAALTPKAEIEG RECA_AZOSE 128 4 -
IADMLVRSGGLDVVVVDSVAALTPKAEIEG RECA_HALHL 129 4 -
IVDSLVRSNAVDLIVVDSVAALTPKAEIEG Q1MYV6_9GAMM 127 4 -
VTDMLVRSGACDVLVVDSVAALTPRAEIEG Q1YR87_9GAMM 127 4 -
ICDALTRSGAVDVIVVDSVAALTPKAEIEG RECA_SHESH 129 4 -
IVDTLVASGAVSLVVVDSVAALTPKSEIEG RECA_PARDE 140 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEF5 127 4 -
ITDMLVRSGSVDVIVVDSVAALTPKAEIEG A0YD74_9GAMM 129 4 -
IADMLVRSGALDIIVIDSVAALVPRAEIEG Q5QJ16_MYCSM 130 4 -
IADMLVRSGALDIIVIDSVAALVPRAEIEG RECA_MYCSM 130 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG Q1KMW1_NEIME 128 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG RECA_NEIMB 128 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG RECA_NEIMA 128 4 -
ICDTLVRSGGIDMVVVDSVAALVPKAEIEG Q1KMW8_NEIME 128 4 -
IADMLIRSGALDIIVIDSVAALVPKAEIEG RECA_KINRD 129 4 -
ICDALTRSGAVDVIIVDSVAALVPKAEIEG RECA_SHEAM 129 4 -
IVDTLVRSGAVSMIVVDSVAALTPKSELEG A6E088_9RHOB 140 4 -
IADMLVRSGALDIIVIDSVAALVPRAEIEG Q5QJ28_9MYCO 130 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B2PTZ5_PROST 140 4 -
IVDALVRSGSVDLVIVDSVAALTPKAEIEG A6GU74_9BURK 136 4 -
ICDMLVRSSGVDVIVVDSVAALVPKAEIEG RECA_CHRVO 129 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG A9HM16_GLUDA 162 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG B5ZD74_GLUDA 131 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG Q6YI31_9ENTR 129 4 -
IADMLVRSGAVDVVVIDSVAALTPKAEIEG B6BZW2_9GAMM 128 4 -
IADMLVRSGAVDVVVIDSVAALTPKAEIEG Q3JCL0_NITOC 128 4 -
ISDMLVRSNAVDVIIVDSVAALTPKAEIEG A6EV17_9ALTE 127 4 -
IAESLVRSGAIDVIVIDSVAALVPRAEIEG Q3ACX3_CARHZ 127 4 -
IADMLIRSGALDLIVIDSVAALVPRAEIEG RECA_NOCSJ 128 4 -
IAETLVRSGAIDVLVIDSVAALVPKAEIEG A1ATV2_PELPD 133 4 -
IVDSLVRSGAVDMIVVDSVAALTPRAEIEG RECA_DELAS 135 4 -
ICDALVRSGAVDVVIVDSVAALTPKAEIEG RECA_HAES1 129 4 -
ICDALVRSGAVDVVIVDSVAALTPKAEIEG RECA_HAES2 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B6XAT0_9ENTR 129 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG Q165U4_ROSDO 140 4 -
ITETLVRSGAVDVLVVDSVAALTPRAEIDG RECA_BARBK 126 4 -
IADMLVRSGSVDIVVVDSVAALTPKAEIEG RECA_XANAC 127 4 -
IADMLVRSGSVDIVVVDSVAALTPKAEIEG RECA_XANCI 127 4 -
ICDALARSGAIDVLVIDSVAALTPKAEIEG A3XXM0_9VIBR 127 4 -
ICDALARSGAIDVLVIDSVAALTPKAEIEG B7VK57_VIBSL 131 4 -
IADMLVRSGAIDLIVIDSVAALVPRAEIEG Q5QJ25_9MYCO 129 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_AZOVI 127 4 -
ITETLVRSGAVDVLVVDSVAALTPRAEIDG RECA_BART1 126 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG RECA_PSEPF 127 4 -
IADMLIRSGALDILVVDSVAALVPRAEIEG RECA_RHOSR 130 4 -
IADMLVRSGALDIIVIDSVAALVPRAEIEG RECA_FRASC 128 4 -
IVEVLVRSGAIDVLVVDSVAALVPRAEIEG Q1K3C4_DESAC 129 4 -
ITDMLVRSNAIDVIIVDSVAALVPKAEIEG A4XWQ4_PSEMY 127 4 -
ITDMLVRSGAVDVVIVDSVAALVPKAEIEG B4X4W3_9GAMM 126 4 -
ITDMLVRSGAVDVVIVDSVAALVPKAEIEG Q0VNJ9_ALCBS 126 4 -
ITETLVRSGAVSMVVVDSVAALTPKSELEG A8LLK7_DINSH 140 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SODGL 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_SODGM 129 4 -
IADMLVRSGSIDLIVIDSVAALVPRAEIEG RECA_LEIXX 129 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG B7HDQ4_BACC4 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG RECA_BACWK 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG RECA_BACCR 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG RECA_BACC1 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG RECA_BACAN 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG RECA_BACAH 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG Q4MMJ9_BACCE 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG B7ITN1_BACC2 126 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q2M4U4_9MYCO 130 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ31_9MYCO 130 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ30_MYCFO 130 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ19_9MYCO 130 4 -
IAEAFVRSGAVDIIVVDSVAALTPKAEIEG B9EBH1_9STAP 126 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_PROVU 129 4 -
ICDMLIRSGAVGVVVIDSVAALTPKAEIEG Q1ZCX1_9GAMM 130 4 -
ITETMVRSGAVDIIIVDSVAALVPKAEIEG B7Y4S4_RUMHA 132 4 -
IADMLVRSGAIDLIVIDSVAALVPRAEIEG Q2M4U7_9MYCO 129 4 -
IADMLVRSGAIDLIVIDSVAALVPRAEIEG RECA_MYCA9 129 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG RECA_ENTAG 129 4 -
IADMLVRSGAIDLIVIDSVAALVPRAEIEG Q5QJ26_MYCAB 129 4 -
IADMLVRSGAIDLIVIDSVAALVPRAEIEG Q5QGG1_9MYCO 129 4 -
ITETLVRSGAVDVVVVDSVAALVPKAEIEG RECA_SYMTH 130 4 -
IADTLVRSGAIDVLVVDSVAALVPRAELEG RECA_RHOCS 138 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG RECA_PASMU 129 4 -
IADMLVRSGAVDVIIIDSVAALTPKAEIEG RECA_HAHCH 127 4 -
IADMLIRSGALDVIVIDSVAALVPRAEIEG A8L6J1_FRASN 128 4 -
ICDALTRSGAVDVIIVDSVAALTPKAEIEG B6WZU4_9ENTR 129 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ18_9MYCO 130 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q5PXP6_LISSE 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG RECA_LISWE 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG RECA_LISW6 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG RECA_LISSE 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG RECA_LISIV 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q5S3P5_LISWE 126 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG RECA_ACTAC 129 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ22_9MYCO 130 4 -
IAETLVRSGAIDVLVVDSVAALVPKAELEG A7H7H5_ANADF 131 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG A7JUT5_PASHA 142 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG RECA_PASHA 142 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG RECA_STRRM 128 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG B8DFS9_LISMO 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG RECA_LISMO 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG RECA_LISMF 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG RECA_LISIN 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q8G906_LISMO 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q547E3_LISMO 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q540Q2_LISIN 126 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q4EGT3_LISMO 126 4 -
ITETLVRSGAVDVLVVDSVAALTPRAEIDG RECA_BARQU 126 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG A6AW11_VIBHA 127 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG A7MYT7_VIBHB 134 4 -
ICDTLVRSGAVDVLVVDSVAALVPRAELEG A4U369_9PROT 138 4 -
ITEALVRSAAVDVVVVDSVAALVPKAEIEG B1CBR0_9FIRM 135 4 -
IVETIARSGAVDVIVIDSVAALTPKAEIEG RECA_NITSB 127 4 -
IADMLVRSGAIDIIVIDSVAALVPRAEIEG RECA_NOCFA 130 4 -
ICESLVRSNAIDLIVIDSVAALVPKAEIEG RECA_LEPIC 143 4 -
ICESLVRSNAIDLIVIDSVAALVPKAEIEG RECA_LEPIN 143 4 -
IVDTLVRSGAVNMVIVDSVAALTPKSELEG A4EKT9_9RHOB 140 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG RECA_ACICA 127 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG RECA_MANSM 129 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG A6D4F1_9VIBR 127 4 -
IADMLVRSGSIDLVVIDSVAALVPRAEIEG B0RGY9_CLAMS 172 4 -
IADMLVRSGSIDLVVIDSVAALVPRAEIEG RECA_CLAM3 129 4 -
IAEALIRSGAIDIIVIDSVAALVPKAEIDG RECA_CLOD6 129 4 -
ICETLVRSGAIDVIVVDSVAALVPRAEIEG RECA_HERA2 128 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG A3XAW9_9RHOB 137 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q8GNQ3_LISMO 126 4 -
IADMLVRSGALDIIIIDSVAALVPRAEIEG RECA_SALAI 129 4 -
ITDMLVRSNAVDVIIVDSVAALVPKAEIEG A3LE75_PSEAE 127 4 -
ITEALIRSGAIDIIVIDSVAALVPKAEIEG B0AAJ2_9CLOT 129 4 -
ITDTLVRSGAVNMVIVDSVAALTPKSELEG A9GSY4_9RHOB 140 4 -
IADMLVRSGAIDILVIDSVAALVPKAEIEG A8ZY66_DESOH 128 4 -
IADTLVKSGSISVIVIDSVAALTPRAEIEG Q4FMX8_PELUB 119 4 -
IVETLAKSGAIDLVVVDSVAALTPKSEIEG RECA_CAMHC 127 4 -
IADTLVKSGSISVIVIDSVAALTPRAEIEG Q1V252_9RICK 144 4 -
IAEALVRSGAVDMIVVDSVAALVPKAEIEG A8VT65_9BACI 126 4 -
IAEALIRSGAIDIIVVDSVAALVPKAEIEG B6FZD0_9CLOT 129 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAEQ 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAES 127 4 -
IADMLVRSGALDIIVIDSVAALVPRAEIEG RECA_SALTO 129 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG Q2FHF3_STAA3 102 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAW 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAU 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAT 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAS 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAR 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAN 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAM 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAE 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAC 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAAB 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAA9 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAA2 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAA1 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG Q2FZ09_STAA8 102 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG B9CVM8_STACP 127 4 -
IADMLIRSGALDILVIDSVAALVPRAEIEG RECA_MYCGI 130 4 -
IADTLIRSGAIDVVVIDSVAALVPRAEIEG RECA_ACIC1 129 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG B7R8S2_9THEO 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG RECA_THETN 127 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG A1A272_BIFAA 159 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG A7A8C4_BIFAD 145 4 -
ICDALVRSGAVDVIIVDSVAALTPKAEIEG B9CWV3_9PAST 143 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAHJ 127 4 -
IVDTLVRSGAISMIVVDSVAALTPKSELEG B5IXK8_9RHOB 139 4 -
ITETMVRSGAVDIVIVDSVAALVPKAEIDG B7BZK5_9FIRM 140 4 -
IAEALVRSGAIDVLVVDSVAALVPKAEIEG B1QSG2_CLOBU 130 4 -
IADMLVRSGAISLIVIDSVAALVPRAEIEG Q5QJ29_MYCCH 129 4 -
IAESLVRSGAIDVIVVDSVAALVPKAEIEG B2A3V4_NATTJ 126 4 -
IVDMLVRSGALDLIVIDSVAALVPRAEIEG B5G7B0_9ACTO 128 4 -
ICDMLVRSGGVDVIVVDSVAALTPRAEIEG RECA_CHRSD 129 4 -
IADMLVRSNAVDVIIVDSVAALTPKAEIEG RECA_MARAV 127 4 -
VSEMLVRSGAVDVLVIDSVAALTPKAEIEG B8KSF1_9GAMM 127 4 -
ITETMVRSGAVDIVIVDSVAALVPKAEIEG A5ZPC8_9FIRM 129 4 -
ICDMLVRSNAVDVIIVDSVAALTPKAEIEG RECA_AERHH 127 4 -
VTEMLVRSGAVDVLVIDSVAALTPRAEIEG B8KI12_9GAMM 127 4 -
IAEALVRSGAVDMLVIDSVAALVPRAEIEG Q8GNQ2_LISMO 126 4 -
ITDMLVRSGAVDLVVVDSVAALTPRAELEG A0L826_MAGSM 138 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG B6XTI1_9BIFI 145 4 -
IVDALARSGAVDLIVVDSVAALTPKAEIEG RECA_ALISL 127 4 -
IAETMVRSGAVDIIIVDSVAALVPKAEIDG B0MJ53_9FIRM 129 4 -
IVETLVRSGAIDVLVVDSVAALVPKAELEG B4UGJ8_ANASK 131 4 -
IVDALVRSGAIDIIVVDSVAALVPKAEIEG B7B4G1_9FIRM 140 4 -
ICDALARSGAVDLIVVDSVAALTPKAEIEG Q2C123_9GAMM 127 4 -
ICDALARSGAVDLIVVDSVAALTPKAEIEG Q1ZN94_9VIBR 127 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIDG B0K1B8_THEPX 126 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIDG B0K9N2_THEP3 126 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG RECA_CAMJD 127 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG A6B6D9_VIBPA 134 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG RECA_VIBPA 127 4 -
ITEALVRSGAVDVIVVDSVAALVPRAEIEG B1II35_CLOBK 134 4 -
ITEALVRSGAVDVIVVDSVAALVPRAEIEG B1KWJ3_CLOBM 134 4 -
ICDALARSGAIDVIVIDSVAALTPKAEIEG RECA_VIBAN 127 4 -
IADMLVRSGAISLLVIDSVAALVPRAEIEG Q5QJ24_MYCCH 129 4 -
ITEALVRSGAVDVIVVDSVAALVPRAEIEG A5I4H9_CLOBH 131 4 -
ITEALVRSGAVDVIVVDSVAALVPRAEIEG B1QQ14_CLOBO 134 4 -
ITEALVRSGAVDVIVVDSVAALVPRAEIEG B1QEE3_CLOBO 134 4 -
ITEALVRSGAVDVIVVDSVAALVPRAEIEG A7GFZ2_CLOBL 131 4 -
ITEALVRSGAVDVIVVDSVAALVPRAEIEG A7FVX9_CLOB1 131 4 -
ICDMLTRSGAVDVVIIDSVAALVPKAEIEG A4AAD1_9GAMM 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_VIBVY 127 4 -
ICDALARSGAVDVIVVDSVAALTPKAEIEG RECA_VIBVU 127 4 -
IADMLVRSGSIDLIVIDSVAALVPRAEIEG A4AHJ3_9ACTN 129 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG B8K904_VIBPA 142 4 -
IVDTLVRSGAVSMVVVDSVAALTPKSELEG Q28QV9_JANSC 140 4 -
IAETLVRSGALDILVVDSVAALVPKAEIEG RECA_SYNAS 130 4 -
IAEAFVRSGAVDIIVVDSVAALTPKAEIEG B9DPC5_STACA 127 4 -
IADMLVRSGAMDILVIDSVAALVPRAEIEG Q5QJ20_9MYCO 130 4 -
ICDALARSGAIDVLVIDSVAALTPKAEIEG A3UV42_VIBSP 127 4 -
IVETLVRSGAIDVLVVDSVAALVPKAELEG B8J9N8_9DELT 131 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ27_9MYCO 130 4 -
IADTLVRSGALDAVVIDSVAALVPRAEIEG RECA_RUBXD 127 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ34_9MYCO 130 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ32_9MYCO 130 4 -
IADTLIRSGGIDMIIIDSVAALVPKSEIEG RECA_RICB8 128 4 -
IADTLIRSGGIDMIIIDSVAALVPKSEIEG RECA_RICBR 128 4 -
ITEALVRSGAVDVVVIDSVAALVPRAELEG B1I314_DESAP 127 4 -
IAEALVRSGAVDIIVIDSVAALVPKAEIEG B1SQM1_9BACI 60 4 -
IAEALVRSNAIDVLVVDSVAALVPKAEIEG A5N856_CLOK5 130 4 -
IAEALVRSNAIDVLVVDSVAALVPKAEIEG B9E1L6_CLOKL 130 4 -
ICDMLVRSNAVDVIIVDSVAALTPKAEIEG RECA_AERSA 127 4 -
ITDMLVRSGSVDIVVIDSVAALTPRAEIEG RECA_NITEC 128 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG RECA_STAS1 127 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG Q1V5N0_VIBAL 127 4 -
VTDMLVRSGAIDVLVVDSVAALTPRAEIEG B3PJB8_CELJU 132 4 -
IVETLARSGAVDIIVVDSVAALTPKAEIEG A6DBB8_9PROT 127 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ17_9MYCO 130 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG A3YK12_CAMJE 127 4 -
IAEALVRSGAVDILVVDSVAALVPKAEIEG RECA_EXIS2 126 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG RECA_CAMJR 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG RECA_CAMJJ 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG RECA_CAMJE 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG RECA_CAMJ8 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG B5QFR3_CAMJE 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG A5KEY5_CAMJE 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG A3ZFZ0_CAMJE 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG A3ZD29_CAMJE 127 4 -
IVETIARSGAVDLIVVDSVAALTPKAEIEG A3YT62_CAMJE 127 4 -
IVETIARSGAIDLIVVDSVAALTPKAEIEG Q4HE44_CAMCO 127 4 -
IADTLVRSGALELIVVDSVAALTPKAEIEG A5X9E4_PROAC 129 4 -
IADTLVKSGSISVIVIDSVAALTPKAEIEG A4GJZ1_9BACT 144 4 -
IADTLIRSSGIDMIIIDSVAALVPKSEIEG A8GTM6_RICRS 147 4 -
IADTLIRSSGIDMIIIDSVAALVPKSEIEG B0BV65_RICRO 147 4 -
ITETMVRSGAVDIVIVDSVAALVPKAEIDG A9KLQ6_CLOPH 129 4 -
IADTLIRSGGIDMIIIDSVAALVPKSEIEG RECA_RICFE 128 4 -
IADTLIRSGGIDMIIIDSVAALVPKSEIEG RECA_RICTY 128 4 -
IADTLIRSGGIDMIIIDSVAALVPKSEIEG RECA_RICPR 128 4 -
IADTLIRSGGIDMIIIDSVAALVPKSEIEG RECA_RICM5 128 4 -
IADMLVRSGALDILVIDSVAALVPRAEIEG Q5QJ23_MYCPR 130 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG B1S8G9_9BIFI 211 4 -
ICESLVRSNAIDLIVIDSVAALVPKAEIEG Q04T44_LEPBJ 143 4 -
ICESLVRSNAIDLIVIDSVAALVPKAEIEG Q051G6_LEPBL 143 4 -
VAEMLVRSGAVDVLVIDSVAALTPKAEIEG A0Z6J8_9GAMM 127 4 -
ITDMLVRSGSVDVVVVDSVAALTPRAEIEG RECA_NITEU 128 4 -
IVDMLVRSNSVDVIIVDSVAALVPKSEIEG A6W1Q4_MARMS 130 4 -
IAEALVRSGAIDVIVIDSVAALVPRAELEG Q2RJJ6_MOOTA 132 4 -
IADMLIRSGALDIIVIDSVAALVPRAEIEG A8L0T0_FRASN 128 4 -
IADMLIRSGALDILVIDSVAALVPRAEIEG RECA_MYCSJ 130 4 -
IADMLIRSGALDILVIDSVAALVPRAEIEG RECA_MYCSS 130 4 -
IADMLIRSGALDILVIDSVAALVPRAEIEG RECA_MYCSK 130 4 -
IVETIARSGAIDLIVVDSVAALTPKAEIEG Q83TZ0_CAMLA 127 4 -
IVETIARSGAIDLIVVDSVAALTPKAEIEG Q845T1_CAMLA 127 4 -
IADALVSSGAVDIIVIDSVAALVPRAEIDG Q6KCJ2_9ENTE 127 4 -
VAEMLVRSGAVDVLVIDSVAALTPKAEIEG B7RWK5_9GAMM 127 4 -
IADTLVRSGALELVVVDSVAALTPKAEIEG Q5IV60_PROAC 129 4 -
ITDTLIRSGGIDMVIIDSVAALVPKSEIEG RECA_RICCK 128 4 -
ITDTLIRSGGIDMIIIDSVAALVPKSEIEG A8GPU6_RICAH 147 4 -
IVDMLVRSGAISIIVIDSVAALVPRAEIEG Q47RS6_THEFY 573 4 -
IADMLIRSGALDIIVIDSVAALVPRAEIEG RECA_SACEN 129 4 -
ICDALARSGAVDLIVIDSVAALTPKAEIEG Q1Z485_PHOPR 127 4 -
IADMLVRSGAIDILVIDSVAALVPRAEIEG Q2M4U6_9MYCO 130 4 -
IADMLVRSGAIDILVIDSVAALVPRAEIEG Q5QJ21_9MYCO 130 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG B3DR86_BIFLD 166 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG RECA_BIFLO 145 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG RECA_BIFBR 145 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG B9AW73_BIFBR 167 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG B7GQG8_BIFLI 166 4 -
IADMLVRSGAIDILVIDSVAALVPRAEIEG Q2M4U5_9MYCO 130 4 -
IADTLVRSGALELIVVDSVAALTPKAEIEG Q2QJS7_PROAC 129 4 -
IADTLVRSGALELIVVDSVAALTPKAEIEG RECA_PROAC 129 4 -
ICDMLVRSGAIDVVVIDSVAALVPRAEIEG B9CKI0_9ACTN 142 4 -
IVDMLVRSNAIDIIVVDSVAALTPRAEIEG A8PQD9_9COXI 130 4 -
IADALVSSGAVDIIVIDSVAALVPRAEIDG Q6KCJ0_9ENTE 127 4 -
IADALVSSGAVDIIVIDSVAALVPRAEIDG Q6KCJ1_9ENTE 127 4 -
IADALVSSGAVDIIVIDSVAALVPRAEIDG Q6KCK1_9ENTE 127 4 -
IADALVSSGAVDIIVIDSVAALVPRAEIDG Q6KCJ4_9ENTE 127 4 -
IADTLIRSSGIDMIIIDSVAALVPKSEIEG Q7P9T0_RICSI 128 4 -
IVETLARSGAVDIIVIDSVAALTPKAEIEG B9L7U2_9PROT 127 4 -
IADTLVKSGSISVIVIDSVAALTPKAEIEG B6BSI6_9RICK 144 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG RECA_MYCMM 129 4 -
IVETIARSGAIDLIVVDSVAALTPKAEIEG B9KEN1_CAMLA 127 4 -
IVDSLIKSGAVDVIVVDSVAALTPKAEIEG Q2GDN2_NEOSM 123 4 -
IVEALVRSNAIDVIVIDSVAALVPQAEIDG B9MQY3_ANATH 128 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A6VKZ3_ACTSZ 137 4 -
ITETMVRSGAVDIVIVDSVAALVPKAEIDG A8RNZ1_9CLOT 152 4 -
ITDMLVRSGALDMIVIDSVAALTPRAEIEG RECA_PSYWF 128 4 -
ILETLTRSGAVDLIVVDSVAALTPKSEIDG RECA_WOLSU 129 4 -
ITEALVSSKAIDILVVDSVAALVPKAELDG Q1IV37_ACIBL 131 4 -
IVEALVRSNAIDVIVVDSVAALVPQAEIDG A4XLD6_CALS8 128 4 -
IVETLARSGAVDLIVIDSVAALTPKSEIEG RECA_CAMFE 127 4 -
IVETLARSGAVDLIVIDSVAALTPKSEIEG RECA_CAMFF 127 4 -
IVETLVRSGAIDVLVVDSVAALVPKAELEG Q2IGM0_ANADE 131 4 -
IADTLIRSSGIDMIIIDSVAALVPKSEIEG RECA_RICCN 128 4 -
IVENLARSGAIDLIVVDSVAALTPKSEIEG B9D2D4_WOLRE 127 4 -
ICDALARSGAVDVMVIDSVAALTPKAEIEG RECA_VIBF1 127 4 -
ICDALARSGAVDVMVIDSVAALTPKAEIEG RECA_VIBFM 127 4 -
IADMLIRSGALDILVIDSVAALVPRAELEG RECA_MYCA1 129 4 -
IADMLIRSGALDILVIDSVAALVPRAELEG RECA_MYCPA 129 4 -
IAETLVRSNAVDLIVVDSVAALVPQAEIDG A5KTF3_9BACT 139 4 -
IADMLVRSGAIDIIVIDSVAALTPKAEIEG RECA_CORGB 140 4 -
IADMLVRSGAIDIIVIDSVAALTPKAEIEG RECA_CORGL 140 4 -
IADMLIRSGALDILVIDSVAALVPRAEIEG RECA_MYCVP 130 4 -
ICEALVRSGAIDVVVVDSVAALTPRAEIEG A6NW33_9BACE 144 4 -
IVDALARSGAVDLIVVDSVAALTPKAEIEG RECA_PHOPR 127 4 -
IADALVSSGAVDIIVIDSVAALVPRAEIDG Q6KCJ9_9ENTE 127 4 -
IAEAFVRSGAVDIVVVDSVAALTPKAEIEG A7KJJ5_STAXY 127 4 -
IADTLVRSGALELIVVDSVAALTPKAEIEG Q5IV56_PROAC 129 4 -
ITETMVRSGAVDIVVVDSVAALVPKAEIDG B7ATW2_9BACE 129 4 -
IADALVSSGAVDVIVIDSVAALVPRAEIDG Q6KCJ8_9ENTE 127 4 -
ICEALVRSGAVDVVVVDSVAALVPRAEIEG A4J5T8_DESRM 126 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG B7H1V4_ACIB3 127 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG RECA_ACIBY 127 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG RECA_ACIBT 127 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG RECA_ACIBS 127 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG RECA_ACIBC 127 4 -
IVETIARSGAIDLIVVDSVAALTPKAEIEG Q8VLF3_CAMLA 127 4 -
IVETIARSGAIDLIVVDSVAALTPKAEIDG Q4HR02_CAMUP 127 4 -
IADMLVRSGAIDLIVVDSVAALTPKAEIEG B7I9U0_ACIB5 127 4 -
ICDSLVRSSAVDIIIIDSVAALVPRAEIEG B0S1D5_FINM2 131 4 -
IVETLARSGAIDLIVVDSVAALTPKSEIDG A7ZFN0_CAMC1 142 4 -
IADALVSSGAIDIVVIDSVAALVPRAEIDG RECA_ENTFA 127 4 -
IVDMLVRSNSVDVVIVDSVAALVPKSEIEG A3YGX8_9GAMM 52 4 -
ICETLVRSNAVDVVVVDSVAALVPRAEIEG RECA_ROSCS 130 4 -
IAEILVRSGGVDVIVIDSVAALVPRAELEG B5YEC6_DICT6 125 4 -
ITDMLARSGAVDIIVIDSVAALTPKAEIEG A6FHA2_9GAMM 127 4 -
ICDMLVRSNAVNLIVIDSVAALTPKSEIEG A3YH37_9GAMM 133 4 -
IAEILVRSGGVDVIVIDSVAALVPRAELEG B8E2U1_9BACT 125 4 -
ITDMLVRSGAIDMIVIDSVAALTPRAEIEG RECA_PSYA2 128 4 -
ITDMLVRSGAIDMIVIDSVAALTPRAEIEG RECA_PSYCK 128 4 -
ITDMLVRSGAVDIIVIDSVAALTPRAEIEG B6F2Z4_LIBAS 127 4 -
ITETLVRSGAIDVLVVDSVAALVPRAEIEG RECA_BDEBA 138 4 -
IAEILVRSNAIDVIVVDSVAALVPKAEIEG RECA_SYNFM 130 4 -
IVETIARSGAIDLIVVDSVAALTPKAEIEG RECA_CAMLA 127 4 -
IADMLIRSGGIDIIVIDSVAALVPKAEIEG A7BD53_9ACTO 138 4 -
IMDMLVGSGSIDIVVIDSVAALVPKAEIEG B2GKH2_KOCRD 128 4 -
VLETLTRSGAVDLIIVDSVAALTPKSEIEG RECA_SULNB 129 4 -
IVDMLIRSGALDIVVIDSVAALVPRAELEG RECA_MYCUA 129 4 -
IAEILIRSGGVDIIVVDSVAALTPKAEIDG RECA_DESPS 131 4 -
IADALISSGAIDIVVVDSVAALVPRAEIEG RECA_LACBA 127 4 -
IAEALVRSGAVDIIVIDSVAALVPRAELDG Q0AXJ0_SYNWW 132 4 -
ITETMVRSGAVDVIIVDSVAALVPKAEIDG A7VB17_9CLOT 130 4 -
IADALVSSGAVDILVVDSVAALVPRAEIEG Q6KCK4_9LACO 127 4 -
IADMLVRSGAIDIIVIDSVAALTPKAEIEG RECA_CORDI 139 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG B8ZQT5_MYCLE 129 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG RECA_MYCLE 129 4 -
ICEALVRSNAVDVVVVDSVAALVPRAEIEG RECA_ROSS1 130 4 -
ICEALVRSGAIDVVVIDSVAALVPKAEIDG RECA_HELMI 130 4 -
IADALVSSGAVDILVVDSVAALVPRAEIEG Q6KC82_LACPL 127 4 -
IADALVSSGAVDILVVDSVAALVPRAEIEG RECA_LACPL 127 4 -
IADALVSSGAVDILVVDSVAALVPRAEIEG RECA_LACPE 127 4 -
IADALVSSGAVDILVVDSVAALVPRAEIEG Q6KCK2_LACPL 127 4 -
IVDILTRSGAVNLIVVDSVAALVPKAEIEG A4XPD2_PSEMY 127 4 -
IVDILTRSGAVNLIVVDSVAALVPKAEIEG RECA_PSEOL 127 4 -
IADMLVRSGAIDMVVIDSVAALTPKAEIDG RECA_CORU7 137 4 -
IADNLIRSGAIDVIVIDSVAALVPKAEIEG A6EIR5_9SPHI 129 4 -
IVETLVRSGAVDIVVVDSVAALVPQAELEG RECA_CHLP8 142 4 -
IVETLARTGAVDLIVVDSVAALTPKSEVEG A7H0M6_CAMC5 142 4 -
VTETLVRSGAVDIIVIDSVAALVPKAEIEG B5YJG1_THEYD 128 4 -
IADMLIRSGAIDIIVVDSVAALTPKAEIDG RECA_CORJK 137 4 -
ITAHLIASGQIDVLVVDSVAALVPKSELDG Q02AB1_SOLUE 129 4 -
ICDALARSGAIDVMVVDSVAALTPKAEIEG RECA_VIBNA 127 4 -
IAESLVRSAAVDLIVVDSVAALVPRAEIEG B6W918_9FIRM 131 4 -
ICEMLVRSNAIDVIVIDSVAALVPRAEIEG B9LCN0_9CHLR 130 4 -
ICEMLVRSNAIDVIVIDSVAALVPRAEIEG O52394 130 4 -
ICESLVRSNAIDLIVIDSVAALVPKAEIEG RECA_LEPME 140 4 -
IADMLVRSGAIDILVIDSVAALTPKAEIEG RECA_COREF 138 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG B2E872_BIFAN 146 4 -
IADMLIRSGALDVIVIDSVAALVPKAEIEG B8DT97_BIFAN 146 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG RECA_NOSP7 131 4 -
ISDMLIRSTAIDLIVIDSVAALVPRAELEG RECA_TROW8 131 4 -
ISDMLIRSTAIDLIVIDSVAALVPRAELEG RECA_TROWT 131 4 -
IVDALARSGAVDVLVVDSVAALTPKAEIEG A5L337_9GAMM 129 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG B5D1J8_9BACE 146 4 -
ITETMVRSGAMDIIVVDSVAALVPKQEIEG A6BJF8_9FIRM 129 4 -
ICDMLVRSGAIDVIVVDSVAALTPKAELEG A6GK08_9DELT 139 4 -
IAETMARSGAMDIIVIDSVAALVPKQEIEG B0G577_9FIRM 130 4 -
IADALVSSGAVDIVVIDSVAALVPRAEIDG Q6KCI8_9ENTE 127 4 -
ITEHLVRSGAVDLIVVDSVAALVPRAEIEG Q1DCC5_MYXXD 130 4 -
ITEHLVRSGAVDLIVVDSVAALVPRAEIEG REC1_MYXXA 130 4 -
ILETVIRSGAVDLVVVDSVAALTPKVEIDG RECA_ARCB4 127 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG A4KP48_FRATU 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRATW 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRATT 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRATO 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRATN 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRATM 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRATH 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRATF 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG RECA_FRAT1 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG B4AS14_FRANO 126 4 -
IADMLVRSNAVDIIVVDSVAALVPKAEIEG A9GC15_SORC5 134 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG A7YR40_FRATU 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG A7JFJ7_FRANO 126 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG A7JEW1_FRATT 126 4 -
ICEMLVRSNAVDVIVIDSVAALVPRAEIEG B8GAQ9_9CHLR 130 4 -
IADMLVRSGGIDIVVIDSVAALTPKAEIEG RECA_FRAP2 126 4 -
IADALVSSGAVDIVVVDSVAALVPRAEIDG Q6KCI7_9ENTE 127 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A4N0Z4_HAEIN 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG RECA_HAEIN 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG RECA_HAEIG 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG RECA_HAEIE 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG RECA_HAEI8 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A4NW53_HAEIN 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A4NQP5_HAEIN 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A4NNY3_HAEIN 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A4NIB3_HAEIN 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A4NCS2_HAEIN 129 4 -
ICDALVRSGAIDVIIVDSVAALTPKAEIEG A4N6U0_HAEIN 129 4 -
IADMLVRSGAIDIIVIDSVAALTPKAEIEG RECA_CORPS 139 4 -
ILETLTRSGAVDLIVIDSVAALTPKAEIEG RECA_HELHP 128 4 -
IVETLVRSGAVDVVVVDSVAALVPQAELEG A1BIQ4_CHLPD 140 4 -
IAETMVRSGAVDIIVIDSVAALVPKQEIEG A7B2G7_RUMGN 128 4 -
IADKLIRSGAVDIIVVDSVAALVPKAEIEG B1GYL2_UNCTG 129 4 -
IADALVSSGAVDIVVVDSVAALVPRAEIDG Q6KCI5_9ENTE 127 4 -
IADALVSSGAVDIVVVDSVAALVPRAEIDG Q6KCJ7_9ENTE 127 4 -
ITDNLIRSGAIDIIVVDSVAALTPKSEIEG A3XGX2_9FLAO 130 4 -
IADALVSSGAVDIVVVDSVAALVPRAEIDG RECA_ENTHR 127 4 -
ICDVLTRSGAVDVIIVDSVAALTPKAEIEG RECA_BAUCH 129 4 -
IADALVSSGAVDMVVVDSVAALVPRAEIDG Q6KCI6_9ENTE 127 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG A0ZKA5_NODSP 131 4 -
ITETMVRSGAVDIIVVDSVAALVPKAEIDG A5Z6J3_9FIRM 167 4 -
IADALVSSGAVDIVVVDSVAALVPRAEIDG Q3Y1B9_ENTFC 127 4 -
IADALVSSGAVDIVVVDSVAALVPRAEIDG RECA_ENTFC 127 4 -
IVETLVRSGAVDVVVVDSVAALVPQAELEG RECA_CHLCH 142 4 -
ICDSLTRSGAVDLIIVDSVAALTPKAEIDG RECA_WIGBR 129 4 -
ICESLVRSNAIDLIVIDSVAALVPKAEIEG RECA_LEPBA 140 4 -
ICESLVRSNAIDLIVIDSVAALVPKAEIEG RECA_LEPBP 140 4 -
IADALVSSGAIDIIVVDSVAALVPKAEIEG Q1WT13_LACS1 138 4 -
ICDALARSGAIDVMVVDSVTALTPKAEIES A8T9B8_9VIBR 127 4 -
IAEQLVRSGACDVIVVDSVAALVPKAEIEG B8J6W0_9DELT 103 4 -
IADTLISSGAIDIVVVDSVAALVPRAEIEG RECA_LACAC 128 4 -
ITETMVRSGAMDIVVVDSVAALVPRQEIEG B7BJM4_9CLOT 129 4 -
IADALVSSGAIDIVVVDSVAALVPRAEIDG Q6KCI9_9ENTE 127 4 -
IAEQLVRSGACDVIVVDSVAALVPKAEIEG B4UDA1_ANASK 130 4 -
ITETMVRSGAIDIIIVDSVAALVPKAEIDG B0NZS5_9CLOT 129 4 -
IAETMVRSGAMDIIVVDSVAALVPRQEIEG B0ND63_EUBSP 129 4 -
IAEALVRSNAIDVIVIDSVAALVPKAELDG B8CXC0_9FIRM 131 4 -
ICDMLVRSGAIDVVVIDSVAALVPRAEIEG B6GBT7_9ACTN 143 4 -
IAETMVRSGAIDIIVIDSVAALVPKQEIEG B5CR08_9FIRM 140 4 -
IVETLVRSGAVDIIVIDSVAALVPQAELEG O52393 141 4 -
IAEQLIRSSAVDIIVIDSVAALTPKAEIEG A7ACC2_9PORP 146 4 -
IAEQLIRSSAVDIIVIDSVAALTPKAEIEG B7B7E3_9PORP 146 4 -
IADALVSSGAVDIVVIDSVAALVPRAEIDG RECA_ENTMU 127 4 -
IVETLVRSGAVDVVVVDSVAALVPQAELEG RECA_CHLL2 142 4 -
IADQLISSAAVDIVVVDSVAALTPKKEIEG B9ANW3_9BACT 138 4 -
IAENLIRSGAIDIVVIDSVAALTPKAEIEG A4BXB3_9FLAO 132 4 -
IADTLVRSGAVGLIVVDSVAALVPKAELEG B3CT01_ORITI 125 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG RECA_ANASP 131 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG RECA_ANAVA 131 4 -
ITEALVRSGAIDVIVVDSVAALVPRAEIEG A7VTT9_9CLOT 146 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG A6L2X2_BACV8 144 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG B6W2A9_9BACE 144 4 -
IVDQLVRSAAVDIVVVDSVAALTPRAEIEG B5IPP8_9CHRO 167 4 -
IVEYLVCSGAIDVIVVDSVAALTPRAEIEG B9KHJ1_ANAMF 136 4 -
IAETMVRSGAMDIIVIDSVAALVPKQEIEG B6FS94_9CLOT 136 4 -
IADALISSGAVDLVIVDSVAALVPRAEIDG B3XRC0_LACRE 127 4 -
IADALISSGAVDLVIVDSVAALVPRAEIDG RECA_LACRJ 127 4 -
IADALISSGAVDLVIVDSVAALVPRAEIDG RECA_LACRD 127 4 -
IADALVSSGAVDILVVDSVAALVPRAEIEG RECA_LACSS 128 4 -
IVDQLVRSAAVDIVVVDSVAALTPRAEIEG Q05QA7_9SYNE 141 4 -
IVDQLVRSAAVDIVVVDSVAALTPRAEIEG RECA_SYNPW 141 4 -
IVDQLVRSAAVDIVVVDSVAALTPRAEIEG RECA_SYNS3 141 4 -
IVDQLVRSAAVDIVVVDSVAALTPRAEIEG A3YUM4_9SYNE 149 4 -
IADNLIRSGAIDIVVVDSVAALTPKSEIEG A6ELL5_9BACT 132 4 -
IADALVSSGAVDIVVIDSVAALVPRAEIDG RECA_ENTGA 127 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG RECA_SYNE7 133 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG RECA_SYNP6 133 4 -
ICDMLVRSGAIDVVVIDSVAALVPRAEIEG B6G4X5_9ACTN 143 4 -
IMDMLVGSGSLDIVVIDSVAALVPRAEIEG B8HG89_9MICC 129 4 -
IMDMLVGSGSLDIVVIDSVAALVPRAEIEG RECA_ARTAT 129 4 -
IADNLIRSGAIDIVVVDSVAALTPKSEIEG A4ANZ6_9FLAO 150 4 -
IADTLVRSGAVGLIVVDSVAALVPKAELEG A5CCL6_ORITB 125 4 -
IVETLVRSGAVDVVVVDSVAALVPQAELEG Q3B668_PELLD 140 4 -
IVEYLVCSGAIDVIVVDSVAALTPRAEIEG RECA_ANAMM 136 4 -
IVDQLVRSSAVDLVVVDSVAALTPRAEIEG B0C5Y5_ACAM1 131 4 -
IVEYLICSGAIDVIVVDSVAALTPRAEIEG RECA_EHRRG 133 4 -
IVEYLICSGAIDVIVVDSVAALTPRAEIEG RECA_EHRRW 133 4 -
IAEQLIRSSAIDIIVVDSVAALTPKAEIEG Q5LG39_BACFN 115 4 -
IAEQLIRSSAIDIIVVDSVAALTPKAEIEG RECA_BACFR 115 4 -
IVDQLVRSGAIDIVVIDSVAALTPRAEIEG B1X512_PAUCH 136 4 -
ICDALARSGSVDVMVVDSVAALTPKAELEG A9M4P2_9VIBR 142 4 -
IAEQLIRSSAIDIIVVDSVAALTPKAEIEG A7VAG0_BACUN 142 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG RECA_HELAH 129 4 -
IAEQLIRSSAVDIIVIDSVAALTPKAEIEG A6LBZ5_PARD8 147 4 -
IAEALVRSAAFDLVVVDSVAALVPKAELDG A8DJT2_9BACT 130 4 -
IVDQLVRSSAVDLVVVDSVAALTPRAEIEG A8ZPF7_ACAM1 131 4 -
ITDTLVRSGALDVIVIDSVSALVPQAELEG Q2S2C8_SALRD 131 4 -
IADNLIRSGAIDIIVVDSVAALTPKSEIEG A4CHW1_9FLAO 130 4 -
IADNLIRSGAIDIVVIDSVAALTPKSEIEG A2TYC4_9FLAO 132 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG B3JNC6_9BACE 145 4 -
IAEQLVRSGAIDLIVVDSVAALVPKAEIEG A7HGT3_ANADF 130 4 -
IVDQLVRSAAVDIVVVDSVAALTPRAEIEG A3Z8Y2_9SYNE 137 4 -
IVDQLVRSAAVDIVVVDSVAALTPRAEIEG A4CSK9_SYNPV 141 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG A5ZGP0_9BACE 142 4 -
IMDMLIGSGSLDIVVIDSVAALVPRAEIEG A9WQ43_RENSM 164 4 -
ITDNLIRSGAIDIIVIDSVAALTPKSEIEG A0M6E4_GRAFK 132 4 -
IADTLISSGAIDIVVVDSVAALVPRAEIEG A8YUB7_LACH4 128 4 -
IVDQLVRSSAVDLVVVDSVAALTPRAEIEG A8ZLV5_ACAM1 131 4 -
ITEQLVRSGAVDLIVVDSVAALVPRAEIEG Q09CN8_STIAU 103 4 -
IMDMLVGSGSLDVIVIDSVAALVPRAEIEG B0BKA0_9MICC 129 4 -
IADTLISSGAIDIVVVDSVAALVPRAEIEG RECA_LACDA 128 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPG 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPC 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPB 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRP8 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRP6 141 4 -
IADTLISSGAIDIVVVDSVAALVPRAEIEG RECA_LACDB 128 4 -
ITETLVRSGSIDLIVVDSVAALVPRAELEG A3EWF7_9BACT 132 4 -
IAEVLIRSAAVDVIVVDSVAALTPKAEIDG Q1NP94_9DELT 130 4 -
IAEQLIRSSAIDIIVVDSVAALTPKAEIEG B0NNH2_BACSE 142 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRMU 141 4 -
IAEQLIRSSAIDIIVVDSVAALTPKAEIEG B7AIA5_9BACE 142 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG RECA_BACTN 128 4 -
IAETMARSGAIDIIVVDSVAALVPRQEIEG A5KKH5_9FIRM 130 4 -
IVETLVRSGAVDVVVVDSVAALVPQAELEG Q0YRU2_9CHLB 141 4 -
IVDMLVRSGAIDAIVVDSVAALTPRAEIEG A4EC83_9ACTN 121 4 -
IVDQLVRSSAVDLVVVDSVAALTPRAEIEG B0CCZ6_ACAM1 131 4 -
IVDQLVRSAAVDIVVIDSVAALTPRAEIEG RECA_SYNPX 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A5LEG8_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRR6 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPS 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPI 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRP4 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRP2 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B8ZNU7_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B2E6T2_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B2E1Y3_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B2DVL7_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B2DQY6_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B2DKH8_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B1S2Q9_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A5MWD5_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A5MPK3_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A5MHL6_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A5MA70_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A5M2X0_STRPN 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A5LTW1_STRPN 141 4 -
IAEQLVRSGACDVIVVDSVAALVPKAEIEG Q2IFM8_ANADE 103 4 -
IADTLISSGAIDIVVVDSVAALVPRAEIEG A4UAE2_LACHE 128 4 -
ITETMVRSGAVDVVIVDSVAALVPKAEIDG A8SPJ7_9FIRM 137 4 -
IAGKLIDSGAVDLVVIDSVAALVPRAEIDG B9DW65_STRUB 141 4 -
IGEQLIRSSAIDIIVIDSVAALTPKAELEG B6YQ33_AZOPC 142 4 -
IMDMLIGSGSLDVIVIDSVAALVPRAEIEG RECA_ARTS2 129 4 -
IVEYLVCSGAIDVIVVDSVAALTPRAEIEG Q40IG8_EHRCH 133 4 -
IVEYLVCSGAIDVIVVDSVAALTPRAEIEG RECA_EHRCR 133 4 -
IADELVASGAIDIVVIDSVAALVPRAEIEG B3WCM1_LACCB 128 4 -
IADELVASGAIDIVVIDSVAALVPRAEIEG Q03AQ0_LACC3 128 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG RECA_HELPH 129 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG RECA_HELPS 129 4 -
ITETLVRSGSIDLIVVDSVAALVPRAELEG B6ANE8_9BACT 132 4 -
IAEQLIRSSAIDIIVVDSVAALTPKAEIEG B3CCX8_9BACE 142 4 -
IAENLIRSGAIDIIVIDSVAALTPKSEIEG Q26HA5_9BACT 102 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG B1SCW6_9STRE 149 4 -
IAENLIRSGAIDIVVIDSVAALTPKSEIEG A6H1S7_FLAPJ 130 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG RECA_HELPY 129 4 -
IVDQLVRSAAIDVIVIDSVAALVPRAEIEG RECA_GLOVI 144 4 -
IADTLIASGAIDILVVDSVAALVPRAEIDG Q042C2_LACGA 128 4 -
IADTLIASGAIDILVVDSVAALVPRAEIDG RECA_LACJO 128 4 -
IVDQLIRSAAVDLVVVDSVAALTPRSEIEG RECA_PROM1 144 4 -
IVDQLIRSAAVDLVVVDSVAALTPRSEIEG RECA_PROMT 144 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG Q3CZB3_STRAG 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRA5 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRA3 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG Q9F5P5_STRAG 102 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG Q3JYN1_STRA1 102 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG Q3DQA1_STRAG 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG Q3DGG0_STRAG 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG Q3DA70_STRAG 141 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG RECA_HELPG 129 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG B6WDW6_9BACE 142 4 -
IVDQLIRSSAVDLVVVDSVAALTPRSEIEG RECA_PROMA 146 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STREM 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPM 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRP1 141 4 -
IVDQLVRSAAVDLVVVDSVAALTPRAEIEG RECA_SYNSC 139 4 -
IVDQLIRSSAVDLVVVDSVAALTPRAEIEG B9NYQ8_PROMA 135 4 -
IVDQLIRSSAVDLVVVDSVAALTPRAEIEG RECA_PROMS 135 4 -
IVDQLIRSSAVDLVVVDSVAALTPRAEIEG RECA_PROM9 135 4 -
IVDQLIRSSAVDLVVVDSVAALTPRAEIEG RECA_PROM2 135 4 -
IVDQLIRSSAVDLVVVDSVAALTPRAEIEG RECA_PROM0 135 4 -
IVDQLIRSSAVDLVVVDSVAALTPRAEIEG Q1PK73_PROMA 135 4 -
IAEQLIRSSAIDIIVIDSVAALTPKAEIEG A7M5K6_BACOV 142 4 -
IVEALVRSSGIDLVIVDSVAALVPRAEIEG A8SMT5_9FIRM 140 4 -
IVDQLIRSTAVDLVVVDSVAALTPRAEIEG RECA_PROM5 140 4 -
IVDQLIRSTAVDLVVVDSVAALTPRAEIEG RECA_PROMP 140 4 -
IVDQLVRSVAVDIVVVDSVAALVPRAEIEG B5W6W4_SPIMA 131 4 -
IAEHLIRSGAIDIIVIDSVAALVPKGELEG A3HWX3_9SPHI 129 4 -
IVEYLVCSGAIDVIVVDSVAALTPRAEIEG RECA_EHRCJ 133 4 -
IVETLVRSNAIDVVVVDSVAALVPQAELEG B4SFE4_PELPB 140 4 -
IADALVSSGAIDLVVIDSVAALVPRAEIDG Q03EQ5_PEDPA 127 4 -
ITDNLIRSGAIDIIVIDSVAALTPKSEIEG A3U6B8_9FLAO 132 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG O85502 141 4 -
ICEALVRSGAIDAIVVDSVAAMVPRAEIEG A8S787_9FIRM 143 4 -
IVDQLVRSTAVDIIVVDSVAALVPRAEIEG RECA_SYNY3 130 4 -
IVDQLVRSTAVDVVVIDSVAALVPKAEIEG B8HR52_9CHRO 132 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRT1 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRTD 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRT2 141 4 -
IADNLIRSGAIDIVVIDSVAALTPKSEIEG A9DT53_9FLAO 132 4 -
IVDQLVRSAAVDLVVVDSVAALTPRAEIEG A5GVV5_SYNR3 135 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG A1KM75_MYCBP 129 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG RECA_MYCTU 129 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG RECA_MYCBO 129 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG A5U689_MYCTA 129 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG A4KK14_MYCTU 129 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG A2VL74_MYCTU 129 4 -
IADMLIRSGALDIVVIDSVAALVPRAELEG A1QV11_MYCTF 129 4 -
IAELLVRSNAVDVIVIDSVAALVPRAEIEG Q1PYI7_9BACT 135 4 -
IVETIARSGAIDLIVIDSVAALTPKSEIEG B6BH95_9PROT 127 4 -
IVDQLVRSAAVDIVVVDSVAALVPRAEIEG Q2JK85_SYNJB 126 4 -
IVDQLVRSTAVDIVVIDSVAALVPRAEIEG B0C288_ACAM1 132 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRSV 141 4 -
IADSLIRSSAIDIIVIDSVAALTPKAEIEG B0MSV9_9BACT 133 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG RECA_HELPJ 129 4 -
IVEYLVCSGAVDVIVIDSVAALTPRAEIEG RECA_WOLPM 134 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG B7JZS9_CYAP8 131 4 -
IVEYLVCSGAIDVIVVDSVAALTPRAEIEG Q2EFY1_ANACE 134 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG Q8VLM8_HELPY 129 4 -
IVDQLVRSAAVDIVVVDSVAALTPRSEIEG RECA_PROM3 146 4 -
IVDQLVRSAAVDIVVVDSVAALTPRSEIEG RECA_PROMM 146 4 -
ILETITRSGGIDLVVVDSVAALTPKAEIDG RECA_HELP2 129 4 -
IAENLIRSGAIDIVVIDSVAALTPKSEIEG A5FLA2_FLAJ1 130 4 -
IAGKLIDSGAVDLVVIDSVAALVPRAEIDG RECA_STRGC 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRP3 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPF 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPD 141 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A4VSE7_STRSY 80 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG Q9KWG8_STRSU 102 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG A4VYN5_STRS2 142 4 -
IVETLVRSGAVDVVAVDSVAALVPQAELEG A4SD03_PROVI 141 4 -
IVDQLVRSVAVDIVVVDSVAALVPRAEIEG RECA_SPIPL 131 4 -
IAEELVRSTAIGVIVIDSVAALVPKAEIEG A8CPQ2_9CHLR 128 4 -
IAEELVRSTAIGVIVIDSVAALVPKAEIEG Q3Z648_DEHE1 128 4 -
IADNLIRSGAIDIVVIDSVAALTPKSEIEG A2TR45_9FLAO 130 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRP9 141 4 -
ITETLVRSGAVDIIVVDSVAALVPQAELEG RECA_CHLT3 141 4 -
IADMLVRSGGVDIVVIDSVAALTPKAEIEG A7JPI1_FRANO 126 4 -
IADMLVRSSAVDIVVIDSVAALIPQAELEG B8DP00_DESVM 135 4 -
IAESLIRSGAVDIVVIDSVAALTPKSEIEG A3J3B9_9FLAO 130 4 -
IVDQLVRSAAVDVVVIDSVAALVPRAEIEG RECA_CYAA5 131 4 -
IADTLVRSGAIDLIVIDSVAALVPKAEIDG A5TXF8_FUSNP 142 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRAG 141 4 -
IADTLVRSGAIDLIVIDSVAALVPKAEIDG RECA_FUSNN 142 4 -
IADNLVRSGAIDIIVIDSVAALTPKSEIEG A8UIA5_9FLAO 130 4 -
IAESLVRSGAVDVIVIDSVAALTPQAEIAG RECA_TREDE 140 4 -
IADMLVRSAAVDLVVIDSVAALIPQAELEG RECA_DESVH 135 4 -
IADMLVRSAAVDLVVIDSVAALIPQAELEG RECA_DESVV 135 4 -
IVEYLVCSSAVDVIVIDSVAALTPRAEIEG B6Y6M6_9RICK 134 4 -
IVEYLVCSSAVDVIVIDSVAALTPRAEIEG RECA_WOLPP 134 4 -
IAEELVRSAAIGVIVIDSVAALVPKAEIEG A5FPE2_DEHSB 128 4 -
IAEELVRSAAIGVIVIDSVAALVPKAEIEG Q3ZW84_DEHSC 128 4 -
IVDQLVRSAAVDIVVVDSVAALVPRAEIEG Q2JVF7_SYNJA 126 4 -
IAGKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRPZ 141 4 -
IVDQLVRSAAVDVVVIDSVAALVPRAEIEG A3IPB2_9CHRO 131 4 -
IVETLVRSGAVDIVVVDSVAALVPQAELEG B3ENK1_CHLPB 140 4 -
IVDQLIRSAAVELVVVDSVAALTPRAEIEG RECA_PROM4 146 4 -
IAEHLIRSGAIDIIVIDSVAALVPKAEIEG RECA_CYTH3 136 4 -
IVDQLVRSAAVDIVVIDSVAALTPRSEIEG Q05ZF3_9SYNE 141 4 -
IVDQLVRSAAVDIVVIDSVAALTPRSEIEG RECA_SYNS9 141 4 -
IADALIASGAVDIVVVDSVAALVPRAEIEG RECA_LACF3 127 4 -
IVDQLVRSAAVDVVVVDSVAALVPRAEIEG Q4BUQ0_CROWT 131 4 -
IADTLVRPGAVDVLVVDSVAALVPRGELEG RECA_AQUMA 125 3 -
IADQLIRSSAIDIIVIDSVAALTPKKEIEG RECA_PRERU 137 4 -
VVDQLVRSSAVDLVVVDSVAALTPRAEIEG A8ZKA1_ACAM1 131 4 -
IADMLVRSGAVDLVVVDSVAALIPQAELEG B8J369_DESDE 135 4 -
VVDQLVRSSAVDLVVVDSVAALTPRAEIEG A8ZP31_ACAM1 131 4 -
IAEALIKSGSIDMIVIDSVAALVPEAEIAG RECA_ACHLI 128 4 -
IADMLVRSGAVDLVVVDSVAALIPQAELEG B6WXJ7_9DELT 135 4 -
IADALVQSGAVDMIVVDSVAALVPRAEIEG Q03YM4_LEUMM 140 4 -
IADELVASGAIDILVVDSVAALVPRAEIEG B5QRW4_LACRH 128 4 -
IADQLVRSAAVDLIVIDSVAALVPRAEIEG RECA_SYNP2 131 4 -
IAEALIKSGSIDMIVIDSVAALVPEAEIAG RECA_ACHLA 128 4 -
IAETLVRSGAIDLVVVDSVAALVPQVELDG B1C2D5_9FIRM 137 4 -
IACKLIDSGAVDLVVVDSVAALVPRAEIDG RECA_STRTR 141 4 -
ICDQLVRSSAVDLIVVDSVAALTPRAEIEG B4WLQ8_9SYNE 130 4 -
IADALVQSGAVDIIVVDSVAALVPRAEIEG B1MZY7_LEUCK 141 4 -
ITDLLVRSGAVDIVIIDSVAALIPQAELEG B7DL17_DESSA 134 4 -
IADTLVRSGAIDLIVIDSVAALVPKAEIDG Q7P621_FUSNV 142 4 -
IVDQLVRSSAVDIVVIDSVAALVPRAEIEG A8YJ75_MICAE 131 4 -
IVDQLVRSSAVDIVVIDSVAALVPRAEIEG B0JV95_MICAN 131 4 -
IVEYLVCSSAVDVIVVDSVAALTPRAEIEG RECA_WOLTR 134 4 -
IAEKLITSGAVDLVVIDSVAALVPKAEIDG RECA1_LACLA 142 4 -
IVEHLVNSGAVDVIVVDSVAALTPRAEIEG Q2GIE7_ANAPZ 130 4 -
IAEQLIRSSAVDIIVIDSVAALTPKAEIEG RECA_PORG3 136 4 -
IAEQLIRSSAVDIIVIDSVAALTPKAEIEG RECA_PORGI 136 4 -
IVETIARSGAIDLIVIDSVAALTPKSEIEG RECA_SULDN 127 4 -
IVDELVRSGVVDLIVVDSVAALVPRAEIEG B7REZ5_9THEM 130 4 -
IVDELVRSGVVDLIVVDSVAALVPRAEIEG RECA_THESQ 130 4 -
IVDELVRSGVVDLIVVDSVAALVPRAEIEG RECA_THEP1 130 4 -
IVDELVRSGVVDLIVVDSVAALVPRAEIEG RECA_THEMA 130 4 -
ITENLIRSGAIDIIVIDSVAALTPKSEIEG Q1VQU1_9FLAO 133 4 -
IVDQLVRSAAVDIVVVDSVAALVPRAEIEG B7KLB5_CYAP7 131 4 -
IAEKLVRSGAIDLIIIDSVAALVPRAEIEG B2KEX6_ELUMP 127 4 -
ITEMLVKSNAVDVIVVDSVAALVPKAELNG A3ZNU6_9PLAN 165 4 -
IADMLFRSGAVDVIVKDSVAALTPKAEIEG RECA_ACIFA 129 4 -
IVDELVRSGVVDLIVVDSVAALVPRAEIEG B9K7N7_THENE 130 4 -
IVDELVRSNAVDIVVIDSVAALVPRAEIEG B7ID28_THEAB 131 4 -
IAENLIRSSAIDIIVIDSVAALVPKSELEG B3ETT2_AMOA5 129 4 -
IAETLVRSGAIDLVVVDSVAALVPQVELDG B0N0K4_9FIRM 140 4 -
IVETLVRSGAVDIVVVDSVAALVPQAELEG B4S4R7_PROA2 139 4 -
IVELLARSGAVDVIVVDSVAALVPKAEIEG A6ZIK1_THEAQ 127 4 -
IAESLINSGAVDVIVVDSVAALVPRDELEG A8UQJ4_9AQUI 135 4 -
IVDQLVRSAAVDIVVIDSVAALVPRAEIEG B4VLI9_9CYAN 132 4 -
IVELLARSGAVDVIVVDSVAALVPKAEIEG B7A501_THEAQ 127 4 -
IVELLARSGAVDVIVVDSVAALVPKAEIEG RECA_THEAQ 127 4 -
IAEKLITSGAVDLVVIDSVAALVPKAEIDG RECA_LACLC 142 4 -
IAEKLITSGAVDLVVIDSVAALVPKAEIDG RECA_LACLS 142 4 -
IAEKLITSGAVDLVVIDSVAALVPKAEIDG RECA_LACLM 142 4 -
IVEMLARSSAVDVIVVDSVAALTPKAEIEG A9G764_SORC5 131 4 -
IADMLVRSNAVDVVVIDSVAALIPQSELEG RECA_DESDG 135 4 -
IADDLVNSGAIDLLVIDSVAALVPRAEIEG RECA_OENOB 127 4 -
IVDQLVRSTAVDIIVVDSVAALVPRAEIEG RECA_THEEB 134 4 -
IAEHLIRSGAIDLMVIDSVAALVPKAEIEG A1ZUC7_9SPHI 131 4 -
IAESLINSGAVDVIVVDSVAALVPKDELEG RECA_AQUPY 133 4 -
IAELLARSGAVDVLVIDSVAALVPKSELEG B5LMU1_9CHLA 129 4 -
ICETLARSNALDVIVIDSVAALVPKAELEG B2ERF9_9BACT 173 4 -
IADMLVRSGAVDLVVVDSVAALIPQTELEG Q1MP41_LAWIP 134 4 -
ITDLLIRSGAIDLVVVDSVAALVPQAELDG A8RC56_9FIRM 134 4 -
IAESLINSGAVDVIVVDSVAALVPKDELEG O67905 130 4 -
IAEMLARSNAVDVIVIDSVAALVPKSELEG Q6M9N0_PARUW 134 4 -
ICEMLVKSNAVDVIIIDSVAALVPKAELEG RECA_RHOBA 150 4 -
IVELLARSGAVDVIVVDSVAALVPRAEIEG RECA_THET2 127 4 -
IVELLARSGAVDVIVVDSVAALVPRAEIEG RECA_THET8 127 4 -
IVDELVRSNAVDLVIIDSVAALVPRVEIEG A8F8W0_THELT 132 4 -
ITETLIRSNAIDVIVIDSVAALISKSELDG B5JPT4_9BACT 137 4 -
IVELLARSGAVDVIVVDSVAALVPGAEIEG RECA_THETH 127 4 -
IAEMLIKSNSVDVIVVDSVAALVPKAELDG A6CF28_9PLAN 144 4 -
ICEALVRSNAIDVIVVDSVAALVTKQELEG B2UPW5_AKKM8 140 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLMU 129 4 -
IMELLVRSGAIDVVVVDSVAALTPRAEIEG B1NEZ0_9DEIO 140 4 -
IMELLVRSGAIDVVVVDSVAALTPRAEIEG RECA_DEIGD 140 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLT2 129 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLTR 129 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLTB 129 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLTA 129 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLPN 129 4 -
IVDELVRSNAVDLVVIDSVAALVPRAEIEG RECA_THEM4 130 4 -
IVESLVRSNAVDLVVVDSVAALVPRAEIEG B6YNU1_9BACT 132 4 -
IMLMLVESGAVDLVVVDSVAALVPQAELDG B7C8F6_9FIRM 132 4 -
IVDSLVRSNIVDLIVVDSVAALVPKAEIEG RECA_PETMO 134 4 -
IVDLLVKSGEVSIIVVDSVAALVPRAELEG B5A778_9CAUD 120 4 -
IADSLARTGAVGLIVIDSVAALIPKAELEG A6FZ21_9DELT 151 4 -
IMETLARSGAIDIVVLDSVAAMVTKAEIDG B0MMT9_9FIRM 146 4 -
IVDELVRSNAVDLIVVDSVAALVPRAEIEG A7HMK5_FERNB 129 4 -
IVDQLVRSAAVDVIVVDSVAALVPRAELEG B5YLR6_THAPS 190 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLAB 129 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLCV 129 4 -
IAELLARSGAVDVIVIDSVAALVPKSELEG RECA_CHLFF 129 4 -
IASALIQSSAVDIIVIDSVAALVPKKELEG Q2RLQ9_MOOTA 127 4 -
ICDTLVRTNAIDVLVIDSVAALVPKAEIEG A6PMM6_9BACT 136 4 -
ITETLVRSSAVDLIIIDSVAALVPKQEIEG B0VJL1_9BACT 128 4 -
IAEMLIESAAVDIVVIDSVAALVPKAEIEG B3WAZ9_LACCB 141 4 -
IAEMLIESAAVDIVVIDSVAALVPKAEIEG Q034K4_LACC3 141 4 -
IAEMLIESAAVDVVVIDSVAALVPKAEIEG B5QRV4_LACRH 141 4 -
IMELLVRSGAIDVVVVDSVAALTPRAEIEG RECA_DEIRA 140 4 -
IAETLVRSNAVDVIVIDSVAALVPKAEIEG B2V7T2_SULSY 132 4 -
IAESLVRSGAVDIIVVDSVAALTPQAEIQG RECA_TREPA 141 4 -
IAESLVRSGAVDIIVVDSVAALTPQAEIQG RECA_TREPS 141 4 -
IAETLIRSNAVDVIVIDSVAALTPRAEIEG B3DW93_METI4 103 4 -
IAEYLIRSGGVDLIVVDSVAALTPQAEIDG RECA_BORHD 141 4 -
IAEYLIRSGGVDLIVVDSVAALTPQAEIDG RECA_BORHE 141 4 -
IVDLLVKSGELSIVVVDSVAALVPRAELEG B5A674_9CAUD 120 4 -
IVDLLVKSGELSIVVVDSVAALVPRAELEG Q857P7_9CAUD 120 4 -
IVDLLVKSGELSIVVVDSVAALVPRAELEG Q1A0V6_9CAUD 120 4 -
IAEYLIRSGGVDLIVVDSVAALTPQAEIDG RECA_BORDL 141 4 -
IAEELSKSGAVDVIVIDSVAALVPKAELDG B5Y8R3_COPPD 135 4 -
LVDTFIRSGSVDVIVVDSVAALVPKSELEG B8LRS8_PICSI 218 4 -
IAEHLIRSGGIDLIVVDSVAALTPKLEIDG B7XTL8_BORGA 143 4 -
IAEHLIRSGGVDLIVVDSVAALTPKLEIDG B7J164_BORBZ 143 4 -
IAEHLIRSGGVDLIVVDSVAALTPKLEIDG RECA_BORBU 143 4 -
IAEHLIRSGGVDLIVVDSVAALTPKLEIDG B9AAC3_BORBU 143 4 -
IAEHLIRSGGIDLIVVDSVAALTPKLEIDG RECA_BORAP 143 4 -
IAEALIRSNAIDVIVIDSVAALISKQELDG A7CVA2_9BACT 168 4 -
IADAFINSNTVDIIVVDSVAALVPKDELEG B4U5L7_HYDS0 128 4 -
IMETLIRSNSIDVIVLDSVAALITKAELDG B1ZWP7_OPITP 140 4 -
IAEHLIRSGGIDLIVVDSVAALTPKLEIDG B7XUE1_BORGA 132 4 -
TADRMCRSGAVDLICVDSVSALTPRAEIEG RECA_ARATH 204 4 -
IAEHLIRSGGIDLIVVDSVAALTPKLEIDG RECA_BORGA 143 4 -
IADRMCRSGAIDLICIDSVSALTPRAEIEG B8AN40_ORYSI 209 4 -
IADRMCRSGAIDLICIDSVSALTPRAEIEG Q10G85_ORYSJ 191 4 -
IADRMCRSGAIDLICIDSVSALTPRAEIEG B9F9W5_ORYSJ 209 4 -
TVDHFVRSTGVDVIVVDSVAALVPKAELEG A4PHN2_PHYPA 200 4 -
IADRMCRSGAVDLICVDSVSALTPRAEIEG B9SVD4_RICCO 114 4 -
VVDTLVRSSAVDLICVDSVAALVPRSEIEG A4S409_OSTLU 131 4 -
IADRMCRSGAIDLICIDSVSALTPRAEIEG B6T788_MAIZE 187 4 -
IAQTLISSNSIDVLVIDSVAALTPRAELDG A6DUF6_9BACT 133 4 -
VVDTLVRSSAVDLIVVDSVAALVPRSEIEG Q00ZP1_OSTTA 158 4 -
IVDILAKSGSIDLIVVDSVAALVPEAELNG RECA_MYCPU 135 4 -
IVDILAKSSSIDLIVVDSVAALVPEVELNG RECA_MYCMO 123 4 -
IVDTLTKTKAIDLIVVDSVAALVPMAELQG RECA_MYCH2 128 4 -
IVDTLTKTKAIDLIVVDSVAALVPMAELQG RECA_MYCHJ 128 4 -
IVDTLTKTKAIDLIVVDSVAALVPMAELQG RECA_MYCH7 128 4 -
TADRMCRSGAVDIIVIDSVSALTPRAEIEG A4PHN3_PHYPA 221 4 -
IVDILAKSGAVDLIVVDSVAALVPIAELEG A5IYZ1_MYCAP 134 4 -
ILETLVKSNSISLIVVDSVAALVPKTELEG RECA_MESFL 131 4 -
IATSLIKSGSISLLVIDSVAALTPESELMG B3R0F8_APPPP 136 4 -
IVDILAKSGNVDLIVVDSVAALVPEAELNG Q4A5K2_MYCS5 125 4 -
ILEMLINSNSIDLIIVDSVAALVPKTELEG RECA_MYCMS 142 4 -
ILEMLINSNSIDLIIVDSVAALVPKTELEG Q2SRU1_MYCCT 125 4 -
IVDSLAKTGAIDLIVVDSVAALVPEVELQG B3PM51_MYCA5 130 4 -
VMDELCRSNVCDLVVIDSVAALVPRAELEG A8I670_CHLRE 183 4 -
ILEMLINSNSIDLIVVDSVAALVPKTELDG RECA_MYCMY 143 4 -
IIDALIKTNMVDLIVVDSVAALVPKNDIES RECA_MYCPE 125 4 -
MIETLIKTNSIDLIVIDSVAAMLPESEYQA B1RUM9_UREPA 127 4 -
MIETLIKTNSIDLIVIDSVAAMLPESEYQA RECA_UREPA 127 4 -
MIETLIKTNSIDLIVIDSVAAMLPESEYQA RECA_UREP2 127 4 -
MIETLIKTNSIDLIVIDSVAAMLPESEYQA B2D8D9_UREPA 127 4 -
MIETLIKTNSIDLIVIDSVAAMLPESEYQA B1RW17_UREPA 127 4 -
IANLLFEKMLLNLVVVDSVAALAPLAELNG Q9LA65_PEWBP 128 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA B1RXB9_UREUR 127 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA RECA_UREU1 127 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA B5BMD7_UREUR 127 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA B3XV19_UREUR 127 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA B3XSE0_UREUR 127 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA B2NH97_UREUR 127 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA B2NFD6_UREUR 127 4 -
MIETLIKTNSIDLIVVDSVAAMIPESEYQA B2D9Z3_UREUR 127 4 -
IIKSLIKTELIDLIVVDSVAALVPKVEIEG Q8RP56_MYCGA 147 4 -
IVDVLTKSGSVDVIVVDSVAALAPQCELDA RECAM_ARATH 185 4 -
LMESLIKTNKVALIVVDSVAALIPKQELEG RECA_MYCPN 128 4 -

Motif 3 width=30
Element Seqn Id St Int Rpt
LQARLMSQALRKLTGSISKSNTMVIFINQI RECA_PARL1 176 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI B8GQV3_9GAMM 166 8 -
LQARLMSQALRKLTANIKRTNTLVIFINQI RECA_METFK 166 8 -
LQARLMSQSLRKLTGSINRSKCMVIFINQL Q2N9K3_ERYLH 176 8 -
LQARLMSQSLRKLTGSINRSKCMVIFINQL A3WBC0_9SPHN 176 8 -
LQARLMSQALRKLTGSISRSRCMVIFINQV Q2G8V4_NOVAD 178 8 -
LQARLMSQALRKLTGSISRSNCLVIFINQI A3VUD5_9PROT 175 8 -
LQARLMSQSLRKLTGSISRSRCMVIFINQL Q1GSD4_SPHAL 179 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI A5VQX5_BRUO2 240 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_BRUSU 177 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_BRUME 177 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_BRUC2 177 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_BRUAB 177 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_BRUA2 177 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_BRUA1 177 8 -
LQARLMSQSLRKLTGSINRSKCMVIFINQL A5P749_9SPHN 165 8 -
LQARLMSQALRKLTANIKRTNTLVIFINQI Q3SGU3_THIDA 186 8 -
LQARLMSQALRKLTGNIKRSNCCVIFINQI RECA_CHRVI 166 8 -
LQARLMSQALRKLTASISRSNCMVIFINQI RECA_OCHA4 177 8 -
LHARLMSQALRKLTANIKKTNTLVIFINQI RECA_DECAR 166 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_BRUSI 177 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI B6R0D5_9RHOB 176 8 -
LQARLMSQALRKLTGNIKRTNTLVIFINQI RECA_METCL 166 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQL B3KIK6_9BACI 140 8 -
LQARLMSQALRKLTANIKRTNTLVIFINQI RECA_METFL 166 8 -
LQARLMSQALRKLTATIKKTNCMVIFINQI B7YNW3_VARPD 178 8 -
LQARLMSQALRKLTGSISRSKCMVIFINQV Q1NDI6_9SPHN 205 8 -
LQARLMSQALRKLAGVINKSRTTAIFINQL A3DEA3_CLOTH 164 8 -
LQARLMSQALRKLAGVINKSRTTAIFINQL B4BH94_CLOTM 164 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI B0JBR8_RHILT 177 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI RECA_RHILW 177 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI RECA_RHIL3 177 8 -
LQARLMSQALRKLTANISRTNTLVIFINQI B7J7A9_ACIF2 166 8 -
LQARLMSQALRKLTANISRTNTLVIFINQI RECA_ACIF5 166 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI RECA_RHIE6 177 8 -
LQARLMSQALRKLTGSISKSRCMVIFINQI A8TPM0_9PROT 176 8 -
LQARLMSQALRKITGSISRSKCLVIFINQI A5V3L4_SPHWW 179 8 -
LQARLMSQALRKLTGSISKSKCMVIFINQI Q0BYM2_HYPNA 169 8 -
LQARLMSQALRKLTASINKSHTMVIFINQI RECA_BRAJA 177 8 -
LQARLMSQALRKLTGSINRTNTTVIFINQI RECA_HERSE 173 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI B9JFS7_9RHIZ 177 8 -
MQARLMSQALRKLTASISKSKCMVIFINQI A0NP88_9RHOB 163 8 -
LQARLMSQALRKLTASISKSKCLVIFINQI A3UDY2_9RHOB 176 8 -
LQARLMSQALRKLTASISRSQTMVIFINQI B2IHX1_BEII9 164 8 -
LQARLMSQALRKLAGVISKSRTTAIFINQL B8I7D2_CLOCE 164 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B2SYF4_BURPP 176 8 -
MQARLMSQALRKLTASISKSNCMVIFINQI RECA_RHIME 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACHD 164 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQI RECA_PSEA6 165 8 -
LQARLMSQALRKLSGSINKSNTTAIFINQL A6TRJ2_ALKMQ 163 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI A4YXR0_BRASO 177 8 -
MQARLMSQALRKLTASISRSNTMVIFINQI RECA_MESSB 177 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_RALME 175 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI A3WVK2_9BRAD 177 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI RECA_NITWN 177 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI A4IMG9_GEOTN 140 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI B4BIW4_9BACI 165 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI Q13AC3_RHOPS 178 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI B7GJN3_ANOFW 210 8 -
LQARLMSQALRKLTASISRSNTMVIFINQI RECA_RHILO 177 8 -
LQARLMSQALRKLTGTVSRSNTLIIFINQI RECA_RHORT 177 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI RECA_RHILV 164 8 -
LQARLMSQALRKLTANIKRSNTLCIFINQI RECA_ALTMD 165 8 -
MQARLMSQALRKLTASISKSNCMVIFINQI RECA_SINMW 177 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI B5JVA0_9GAMM 165 8 -
LQARLMSQALRKLTANIKRTNTLVIFINQI RECA_THICR 166 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI B8IP29_METNO 179 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_METS4 179 8 -
LQARLMSQALRKLTGNIKQTNTMVIFINQI A1T002_PSYIN 168 8 -
LQARLMSQALRKLTGNIKKTNTLVIFINQI B6BWK4_9PROT 166 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI B7QSS1_9RHOB 177 8 -
MQARLMSQALRKLTASISKSNCMVIFINQI RECA_RHIEC 177 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI A2UZ65_SHEPU 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHESW 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEPC 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEB9 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEB8 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEB5 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B8E8U2_9GAMM 167 8 -
LQARLMSQALRKLTASISKSNTMVIFINQI RECA_RHILP 177 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI RECA_NITHX 177 8 -
LQARLMSQALRKLSGAINKSRTLAIFINQI Q2B1K9_9BACI 155 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI B3QI72_RHOPT 178 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI RECA_RHOPA 164 8 -
LQARLMSQALRKLTASISKSNCIVLFINQI B4WEL0_9CAUL 177 8 -
LQARLMSQALRKLAGSISKSNTIAIFINQL A8MFC2_ALKOO 163 8 -
LQARLMSQALRKLTGSIKRTNCLVIFINQI Q2T0V0_BURTA 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A4JHK1_BURVG 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_BURS3 166 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_BURCJ 166 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_BURCE 166 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI Q0BC68_BURCM 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B1YVY9_BURA4 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B1T7P6_9BURK 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B1FQP9_9BURK 175 8 -
LQARLMSQALRKLTASISKSKCMVIFINQI RECA_AGRTU 177 8 -
LQARLMSQALRKLTGIISKSRTTAIFINQI A1HUE5_9FIRM 164 8 -
LHARLMSQALRKLTGSISKSNCLVIFINQI RECA_AZOLI 177 8 -
LQARLMSQALRKLTASISRSNTMVIFINQI B8ETR1_METSI 177 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI Q13UH6_BURXL 176 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI Q842H8_9BURK 176 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B1G226_9BURK 176 8 -
VQARLMSQAMRKLTGSISRSKCTVIFINQI A6FSR2_9RHOB 178 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A1V6W5_BURMS 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_BURPS 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_BURMA 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_BURM1 166 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI Q3JVL9_BURP1 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B9CCE0_9BURK 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B9BTL7_9BURK 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B9B3Z8_9BURK 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B7CIU0_BURPS 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B2H414_BURPS 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B1HFF1_BURPS 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A9K5W0_BURMA 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A8KKV8_BURPS 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A8E9V2_BURPS 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A5XX15_BURMA 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A5TR11_BURMA 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A5JC36_BURMA 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A3NRX4_BURP0 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A3N690_BURP6 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A3MH63_BURM7 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A2W7P8_9BURK 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A2S8U6_BURM9 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_RALEJ 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B5WK23_9BURK 176 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A0KA75_BURCH 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI Q1BTW3_BURCA 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B1JY17_BURCC 175 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A2VVQ7_9BURK 175 8 -
MQARLMSQALRKLTGSISRSKCMVIFINQI Q1YEB7_MOBAS 177 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_ALHEH 167 8 -
VQARLMSQAMRKLTGSISRSKCTVIFINQI A3SNY5_9RHOB 170 8 -
LQARLMSQALRKLTGIISKSNCCVIFINQI B3E9Z2_GEOLS 165 8 -
AQARLMSQAMRKLTASIGRSNCMVIFINQI RECA_RHOCA 178 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI A4VJP2_PSEU5 140 8 -
MQARLMSQALRKLTGSISRSKCMVIFINQI Q0FZI3_9RHIZ 177 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI Q07R91_RHOP5 177 8 -
LQARLMSQALRKLTATIKKTNCMVIFINQI A1WCY0_ACISJ 177 8 -
LQARLMSQALRKLTATIKKTNCMVIFINQI B9MHR9_9BURK 177 8 -
VQARLMSQAMRKLTGSIARSNCMVIFINQI A3VJG5_9RHOB 181 8 -
LQARLMSQALRKLSGSINKSKTIAIFINQI B1HR36_LYSSC 140 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI Q8GJ70_BACME 164 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI B6JBM2_OLICO 177 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_RALEH 175 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACSK 164 8 -
VQARLMSQAMRKLTGSISRSKCMVIFINQI B6BE26_9RHOB 176 8 -
LQARLMSQGLRKLTGTIKRTNCLVIFINQI RECA_RALEU 175 8 -
VHARLMSQAMRKLTGSINRSGCMVIFINQI A3V9G1_9RHOB 178 8 -
LQARLMSQALRKITGALSNTNTTAIFINQL A3TMD7_9MICO 173 8 -
LQARLMSQALRKITGNIKTANCLVIFINQI A4BCJ0_9GAMM 170 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI A3RQ47_RALSO 174 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B5SGP7_RALSO 174 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B5S8Q7_RALSO 174 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL B1BG38_CLOPE 168 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL RECA_CLOPE 168 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL RECA_CLOP1 168 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL B1RQ41_CLOPE 168 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL B1RIJ5_CLOPE 168 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL B1RAI9_CLOPE 168 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL B1BWW2_CLOPE 168 8 -
LQARLMSQALRKLTATIKKTNCMVVFINQI A1WET8_VEREI 179 8 -
LQARLMSQALRKLTGAIKRTNTTVIFINQI B1XRZ6_POLNS 182 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI Q8GJ73_BACME 164 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI RECA_METRJ 179 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEON 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHESR 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHESM 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHESA 167 8 -
VHARLMSQAMRKLTGSISRSNCMVIFINQI B6AYP7_9RHOB 170 8 -
LQARLMSQALRNLTANISRSNTLVIFINQI RECA_THIFE 166 8 -
LQARLMSQALRKLTATIKRTNCMVIFINQI RECA_BORPD 174 8 -
LQARLMSQALRKLTASINKSNTMVIFINQI Q218Q7_RHOPB 178 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEDO 167 8 -
LQARLMSQALRKLAGTINKTNCVAIFINQL RECA_CLOB8 168 8 -
LHARLMSQALRKLTGAISKSNTCVIFINQI B8G068_DESHD 167 8 -
LHARLMSQALRKLTGAISKSNTCVIFINQI Q24W60_DESHY 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEFN 167 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI A9W5Y7_METEP 182 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI B7KPS7_METC4 182 8 -
LQARLMSQALRKLTGSISRSNCMVIFINQI B1ZC93_METPB 182 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_SERMA 167 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL Q3R742_XYLFA 165 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL RECA_XYLFM 165 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL Q3RE83_XYLFA 165 8 -
MQARLMSQALRKLTASISKSNTMVIFINQI A7IMQ9_XANP2 177 8 -
LQARLMSQALRKLTATIKKANCMVIFINQI Q122H4_POLSJ 184 8 -
LQARLMSQALRKLTGSINKSKCATIFINQL RECA_CLONN 165 8 -
VHARLMSQAMRKLTGSISRSNCMVIFINQI Q2C9X3_9RHOB 179 8 -
LQARLMSQALRKLTASINKSHTMVIFINQI A5EMM4_BRASB 177 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI A9E4G3_9RHOB 178 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI B7V8D1_PSEA8 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEAE 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEAB 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEA7 165 8 -
LQARLMSQALRKLTATIKKANCMVIFINQI A1VUC3_POLNA 176 8 -
LQARLMSQALRKLTGSISKSKCLVIFINQI Q0AQY8_MARMM 177 8 -
LQARLMSQALRKLTGTINKSNCVVIFINQL RECA_CLOPS 168 8 -
LQARLMSQALRKLTASINKANTIVIFINQI B8H3I7_CAUCR 177 8 -
LQARLMSQALRKLTASINKANTIVIFINQI RECA_CAUCR 177 8 -
LHARLMSQALRKLTGSISRSKTLVIFLNQI RECA_ACICJ 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACLD 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACLI 164 8 -
LQARLMSQALRKLGGAISKSKTIAIFINQL B1DLF1_9BACL 164 8 -
LQARLMSQALRKLTGAIKRTNTTVIFINQI A4SZY2_POLSQ 182 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_LEGPN 166 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_LEGPL 166 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_LEGPH 166 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_LEGPC 166 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_LEGPA 166 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI B2C321_LEGPN 166 8 -
LQARLMSQALRKLTSNIKKTNCMVIFINQI B1XY03_LEPCP 174 8 -
LQARLMSQALRKLTGNIKNANCLCIFINQI B9DEP2_9GAMM 165 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI B9NRH1_9RHOB 175 8 -
LHARLMSQALRKLTGTVSRSNTLVIFLNQI RECA_GLUOX 163 8 -
LQARLMSQALRKLTATIKKTNCMVIFINQI B7X245_COMTE 175 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACCN 164 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL RECA_XYLFA 165 8 -
MQARLMSQALRKLTASISKSNTMVIFINQI A8ICX1_AZOC5 177 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQI A4C6Y7_9GAMM 165 8 -
LQARLMSQALRKLAGTISKTNCIAIFINQL RECA_CLOBA 168 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL RECA_STRMK 165 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_CUPTR 175 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI RECA_PROMI 167 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI RECA_PROMH 167 8 -
LQARLMSQALRKLTGNIKRSNTLCIFINQI Q3IFN0_PSEHT 165 8 -
MQARLMSQALRKLTGSISRSNCMVVFINQI B9JX56_AGRVI 177 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_METCA 166 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL B8L292_9GAMM 186 8 -
LQARLMSQALRKLTATIKRTNCMVIFINQI Q2KYE8_BORA1 173 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSE14 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEU2 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSESM 165 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL B5HF96_STRPR 166 8 -
LAARMMSQAMRKLAGNLKQANTLLIFINQI RECA_ERWCT 167 8 -
VHARLMSQAMRKLTGSISRTNCTVIFINQI A3VX42_9RHOB 178 8 -
LQARLMSQALRKLTATIKKTNCMVIFINQI A1TW37_ACIAC 175 8 -
LQARLMSQALRKLTASISRSNCMVIFINQI A9D6F1_9RHIZ 177 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACP2 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI B4ADR5_BACPU 164 8 -
AQARLMSQAMRKLTGAINKSNCMVIFINQI A3JSX3_9RHOB 177 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI A9EMD9_9RHOB 177 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI A9FNG9_9RHOB 177 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI Q659J5_BACAM 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACSU 163 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACA2 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI Q8GJG2_BACAM 164 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI A6XC70_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALTY 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALTI 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALSV 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALPK 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALPB 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALPA 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALNS 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALHS 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALG2 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALEP 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALDC 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALCH 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SALA4 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5Q846_SALVI 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5PUL0_SALHA 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5PGV9_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5PA02_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5NNK4_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5NBF9_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5N4V4_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5MKA1_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5CBG8_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B5BYR3_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B4A2F6_SALNE 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3YID4_SALET 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI A9MFY8_SALAR 172 8 -
LQARLMSQALRKLTATIKKSNCMVIFINQI RECA_METPP 173 8 -
LQARLMSQALRKLTAHIKKTNCMVIFINQI Q21RF6_RHOFD 200 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANC5 165 8 -
LQARLMSQALRKLTGIISKSNCCVIFINQI A5GDB6_GEOUR 165 8 -
SQARLMSQAMRKLTASIGRSNCMVIFINQI B9KKJ7_RHOSH 188 8 -
SQARLMSQAMRKLTASIGRSNCMVIFINQI RECA_RHOSH 164 8 -
SQARLMSQAMRKLTASIGRSNCMVIFINQI RECA_RHOS1 178 8 -
LQARLMSQALRKLTGIISKSNCCVIFINQI RECA_GEOSL 166 8 -
LQARLMSKALRKLTASIFRSNCMVIFINQI RECA_BARHE 164 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHELP 167 8 -
LHARLMSQALRKLTGSVSKSKTIVIFINQI RECA_MAGMM 177 8 -
MQARLMSQALRKLTASISKSKCMVIFINQI B9R0H5_9RHOB 176 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_KLEP7 167 8 -
LQARLMSQALRKLAGTISKTNCIAIFINQL RECA_CLOBB 168 8 -
LQARLMSQALRKITGSINRSQTLVIFINQV RECA_ZYMMO 163 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI Q4IXX9_AZOVI 165 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_KLEP3 167 8 -
LQARMLSQAMRKLTGNLKKSNTMLIFINQI RECA_COLP3 165 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL RECA_XYLF2 165 8 -
LQARLMSQALRKLTGNIKRSNTLVIFINQL RECA_XYLFT 165 8 -
LQARLMSQALRKLTATIKRTNCMVIFINQI RECA_BORBR 174 8 -
LQARLMSQALRKLTATIKRTNCMVIFINQI RECA_BORPE 174 8 -
LQARLMSQALRKLTATIKRTNCMVIFINQI RECA_BORPA 174 8 -
LQARLMSQALRKLTGAISRSKTAVIFINQL B9KXK1_THERO 164 8 -
LQARLMSQALRKLTANIKRSHSLVIFINQI A4BU37_9GAMM 168 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL RECA_STRAW 166 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL RECA_STRVL 166 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL RECA_STRLI 166 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL O50487 166 8 -
LQARLMSQALRKLTANIKATNCLVVFINQI A3N1E7_ACTP2 182 8 -
LQARLMSQALRKLTANIKATNCLVVFINQI B3GY31_ACTP7 182 8 -
LQARLMSQALRKLTANIKATNCLVVFINQI B0BQ84_ACTPJ 182 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI RECA_ERWCA 167 8 -
VHARLMSQAMRKLTGSIARSNCMVIFINQI A3TWS8_9RHOB 178 8 -
LQARLMSQALRKLTGIISKSNCCVIFINQI B3JUW6_9DELT 168 8 -
LQARLMSQALRKLTGIISKSNCCVIFINQI RECA_GEOBB 168 8 -
VQARLMSQAMRKLTGSINRSKCMVIFINQI A4ERJ5_9RHOB 176 8 -
LQARLMSQALRKLTGIISKSNCCVIFINQI RECA_GEOMG 166 8 -
LAARMMSQAMRKLAGNLKNSGTLLIFINQI RECA_ERWT9 167 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI B2JDB5_BURP8 176 8 -
LQARLMSQALRKLTASISKAKTLVIFINQI B4RHD9_PHEZH 177 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEP1 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEPU 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEPK 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEPG 165 8 -
VQARLMSQALRKLTGTIAKSQTCVIFINQI Q1DCH8_MYXXD 169 8 -
VQARLMSQALRKLTGTIAKSQTCVIFINQI REC2_MYXXA 169 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI A6BYJ2_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPY 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPS 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPP 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPN 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPG 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPB 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERPA 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERP3 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI B0HV90_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI B0HJM0_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI B0H198_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI B0GVR3_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI B0GB33_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI A9ZXU8_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI A9Z5H3_YERPE 167 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI RECA_XENBV 167 8 -
LQARLMSQALRKLTGNIKRSNTLCIFINQI A0XYZ7_9GAMM 165 8 -
LQARLMSQALRKLTANIKNTNCLVVFINQI B0QV50_HAEPR 182 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_SERP5 167 8 -
LQARLMSQALRKLSGAINKSKTTAIFINQI RECA_OCEIH 164 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_CITK8 167 8 -
VHARLMSQAMRKLTGSISRSKCMVIFINQI RECA_SILPO 170 8 -
LQARLMSQALRKMTGAMNNSGTTAIFINQL RECA_AMYMD 167 8 -
LAARMMSQAMRKLAGNLKSSNTLLIFINQI RECA_PHOLL 167 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_STRM5 165 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI A3SGP7_9RHOB 178 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI A3T116_9RHOB 170 8 -
MQARLMSQALRKLTASISRSNCMVIFINQI RECA_RHOVI 164 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ENT38 167 8 -
SQARLMSQAMRKLTASIGRSNCMVIFINQI RECA_RHOS5 178 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI B6A8B5_9ENTR 167 8 -
LQARLMSQALRKLTANIKNTNCLVVFINQI B8F639_HAEPR 182 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL Q308R5_STRAA 166 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL RECA_STRAM 166 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI A1AEN9_ECOK1 172 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHISS 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHISO 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHIFL 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHIF8 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHIDS 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHIBS 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHIB3 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOUT 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOSE 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOLI 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOLC 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOL6 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOL5 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECOHS 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECO5E 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_ECO24 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B7UHB7_ECO27 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B7NSH9_ECO7I 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B7N6S9_ECOLU 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B7MKG8_ECO45 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B7M9D6_ECO8A 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B7LW30_ESCF3 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B7LEB1_ECO55 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B6ZWC2_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3XHH4_ECOLX 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3X0Z2_SHIDY 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3WLX1_ECOLX 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3ILR5_ECOLX 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3I8V5_ECOLX 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3HQ29_ECOLX 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3HDP6_ECOLX 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3BYJ2_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3BJ81_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3B4W2_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3ANH0_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B3A6T9_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B2PF74_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B2P7H8_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B2NRK8_ECO57 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B2N1H9_ECOLX 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B1LQ17_ECOSM 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B1EGX3_9ESCH 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEHH 167 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEFL 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSETO 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEE4 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEPW 165 8 -
VHARLMSQAMRKLTGSISRTKCTVIFINQI B5JZH2_9RHOB 177 8 -
SQARLMSQAMRKLTASIGRSNCMVIFINQI A1AZL5_PARDP 178 8 -
LQARLMSQALRKLSGSINKSKTIAIFINQI A3ICA9_9BACI 164 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL B1VXV8_STRGG 166 8 -
VQARLMSQAMRKLTGSISRSKCMVIFINQI Q1GHA3_SILST 177 8 -
LQARLMSQALRKLAGSINKSNCVAIFINQL RECA_CLOTE 165 8 -
LHARLMSQALRKLTGSVSRSNTMLIFLNQI RECA_ACEPO 169 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B8CJQ6_9GAMM 167 8 -
LHARLMSQALRKLTGSVNRSNTTLIFLNQI Q0BSC0_GRABC 170 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEPA 167 8 -
LQARLMSQALRKLTSNIKKSNTMCIFINQI RECA_IDILO 165 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI RECA_XENNE 167 8 -
LQARLMSQALRKLAGAISKSKTIAIFINQI B7DS99_9BACL 164 8 -
LQARLMSQALRKLTGTINKSNCCVIFINQI Q3A1W3_PELCD 167 8 -
LQARLMSQALRKLTGTIKRTNCLVIFINQI RECA_RALSO 174 8 -
LQARLMSQALRKLNGNVKNANVLLIFINQI A3JHQ1_9ALTE 165 8 -
LHARLMSQALRKLTGNIKRSNTMVIFINQI RECA_NITMU 166 8 -
LQARLMSQALRKLTANIKKSNTLVIFINQI A9KG26_COXBN 165 8 -
LQARLMSQALRKLTANIKKSNTLVIFINQI RECA_COXBU 165 8 -
LQARLMSQALRKLTANIKKSNTLVIFINQI B6J042_COXB2 165 8 -
LQARLMSQALRKLTANIKKSNTLVIFINQI A9ZH63_COXBU 165 8 -
LQARLMSQALRKLTANIKKSNTLVIFINQI A9NCN5_COXBR 165 8 -
LQARLMSQALRKLTANIKRTNTLVIFINQI RECA_AZOSB 166 8 -
LQARLMSQALRKLTGNVKSSNCLLVFINQI Q2BQV7_9GAMM 165 8 -
LQARLMSQALRKLTGTIKKTNCMVIFINQI A7CFE0_BURPI 263 8 -
LQARLMSQALRKLTGTIKKTNCMVIFINQI B2UGD9_RALPJ 174 8 -
LQARLMSQALRKLTASINKSHTMVIFINQI Q2ITM5_RHOP2 179 8 -
VQARLMSQALRKLTGTISKSQTCVIFINQI Q08Y00_STIAU 169 8 -
LQARLMSQALRKLTGTINKTRTCLIFINQI B8FL00_9DELT 167 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A1EPV0_VIBCH 223 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_VIBCH 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_VIBC3 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A6XXS5_VIBCH 223 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A6AEW1_VIBCH 223 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A6A6C3_VIBCH 223 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A3GQD3_VIBCH 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A3ENA6_VIBCH 223 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A3EGF8_VIBCH 223 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A2PUQ2_VIBCH 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A2PKZ0_VIBCH 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A2P8I1_VIBCH 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A1F832_VIBCH 165 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI Q45ND1_MORCA 166 8 -
VHARLMSQAMRKLTASISRSNCMVIFINQI A3K228_9RHOB 170 8 -
LQARLMSQALRKLTAIISKSNCCVIFINQI B9M365_9DELT 165 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_YERE8 167 8 -
LQARLMSQALRKLTASINKANTIVIFINQI RECA_CAUSK 177 8 -
LQARLMSQALRKLTGNIKRANTLVVFINQI RECA_DICNV 166 8 -
AQARLMSQAMRKLTGSIAKSGCMVIFINQI Q0FAQ7_9RHOB 177 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI B7RH74_9RHOB 178 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEST 165 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI A9M0G4_NEIM0 141 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI RECA_NEIMF 166 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI RECA_NEIGO 166 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI RECA_NEIG2 166 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI RECA_NEIG1 166 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI Q1KMW2_NEIME 166 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANOM 165 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANOR 165 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANOP 165 8 -
LAARMMSQAMRKLAGNLKQTNTMLIFINQI RECA_SHEWM 167 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI RECA_ENTS8 167 8 -
LQARLMSQALRKLTGSINRTNTLVIFINQI RECA_HERAR 173 8 -
LQARLMSQALRKLTSNIKKSNSLCIFINQI A3WM74_9GAMM 165 8 -
LQARLMSQALRKMTAALANSGTTAIFINQL RECA_FRAAA 167 8 -
LQARLMSQALRKLTGSINRTNTLVIFINQI RECA_JANMA 173 8 -
LQARLMSQALRKLTGAISKSRTTVIFINQI A5D2R8_PELTS 165 8 -
LQARLMSQALRKLTGSIARSNTIIIFINQI Q0F3T6_9PROT 164 8 -
LQARLMSQALRKLTANIKKSNTLVIFINQI B6J6Y7_COXB1 165 8 -
LQARLMSQALRKITGNIKNANCLAIFINQI RECA_SACD2 165 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI B6FH76_9ENTR 172 8 -
LQARLMSQALRKLTGAIGKSNCVVIFINQL B0P6Q8_9FIRM 183 8 -
LQARLMSQALRKLTANIKATNCLVVFINQI RECA_HAEDU 181 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANC8 165 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANCP 165 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANCB 165 8 -
LQARLMSQALRKLTGSINKSKCIAIFINQL RECA_CLOAB 165 8 -
LQARLMSQALRKITGSINRSQTLVIFINQV Q8GF01_ZYMMO 178 8 -
LQARLMSQALRKLTANIKRTNTLVIFINQI RECA_AZOSE 166 8 -
LQARLMSQALRKLTGSIQRSNTLVVFINQI RECA_HALHL 167 8 -
LQARLMSQALRKLTANVKNANCMVIFINQI Q1MYV6_9GAMM 165 8 -
LQARLMSQALRKLTGNIKNANCLVIFINQI Q1YR87_9GAMM 165 8 -
LAARMMSQAMRKLAGNLKQTNTMLIFINQI RECA_SHESH 167 8 -
SQARLMSQAMRKLTASIGRSNCMVIFINQI RECA_PARDE 178 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEF5 165 8 -
LAARMMSQAMRKMTGNIKNANCLVIFINQI A0YD74_9GAMM 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ16_MYCSM 168 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCSM 168 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI Q1KMW1_NEIME 166 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI RECA_NEIMB 166 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI RECA_NEIMA 166 8 -
LQARLMSQALRKLTGHIKKTNTLVVFINQI Q1KMW8_NEIME 166 8 -
LQARLMSQALRKITGALNHSGTTAIFINQL RECA_KINRD 167 8 -
LAARMMSQAMRKLAGNLKQSNTLLIFINQI RECA_SHEAM 167 8 -
VHARLMSQAMRKLTGSISRTNCTVIFINQI A6E088_9RHOB 178 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ28_9MYCO 168 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI B2PTZ5_PROST 178 8 -
LQARLMSQALRKLTANIKRTNCLVIFINQI A6GU74_9BURK 174 8 -
LQARLMSQALRKLTGNIKRTNTLVIFINQI RECA_CHRVO 167 8 -
LHARLMSQALRKLTGTVSRSNTMMIFLNQI A9HM16_GLUDA 200 8 -
LHARLMSQALRKLTGTVSRSNTMMIFLNQI B5ZD74_GLUDA 169 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI Q6YI31_9ENTR 167 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI B6BZW2_9GAMM 166 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI Q3JCL0_NITOC 166 8 -
LQARLMSQALRKLTGNVKHANCLLIFINQI A6EV17_9ALTE 165 8 -
LQARLMSQALRKLTGAISKSKTVAIFINQM Q3ACX3_CARHZ 165 8 -
LQARLMSQALRKMTGALNNSKTTMIFINQL RECA_NOCSJ 166 8 -
LQARLMSQALRKLTGIISKSNCCVIFINQI A1ATV2_PELPD 171 8 -
LQARLMSQALRKLTATIKKTNCMVIFINQI RECA_DELAS 173 8 -
LQARLMSQALRKLTGQIKNSNCLVVFINQI RECA_HAES1 167 8 -
LQARLMSQALRKLTGQIKNSNCLVVFINQI RECA_HAES2 167 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI B6XAT0_9ENTR 167 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI Q165U4_ROSDO 178 8 -
LQARLMSKALRKLTASIFRSNCMVIFINQI RECA_BARBK 164 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANAC 165 8 -
LQARLMSQALRKLTGNIKRSNTLVVFINQL RECA_XANCI 165 8 -
LQARMLSQAMRKLTGNLKQSNCMAIFINQI A3XXM0_9VIBR 165 8 -
LQARMLSQAMRKLTGNLKQSNCMAIFINQI B7VK57_VIBSL 169 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ25_9MYCO 167 8 -
LQARLMSQALRKITGNIQNANCLVIFINQI RECA_AZOVI 165 8 -
LQARLMSKALRKLTASIFRSNCMVIFINQI RECA_BART1 164 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI RECA_PSEPF 165 8 -
LQARLMSQALRKMTGALSNSGTTAIFINQL RECA_RHOSR 168 8 -
LQARLMSQALRKMTAALANSGTTAIFINQL RECA_FRASC 166 8 -
LQARLMSQALRKLTATISKSNCCVIFINQI Q1K3C4_DESAC 167 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI A4XWQ4_PSEMY 165 8 -
LQARLMSQALRKITGNVKNANTLVVFINQI B4X4W3_9GAMM 164 8 -
LQARLMSQALRKITGNVKNANTLVVFINQI Q0VNJ9_ALCBS 164 8 -
AQARLMSQAMRKLTGAISRSNCTVIFINQI A8LLK7_DINSH 178 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_SODGL 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_SODGM 167 8 -
LQARLMSQALRKLTGALSQTNTTMIFINQL RECA_LEIXX 167 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI B7HDQ4_BACC4 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACWK 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACCR 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACC1 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACAN 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_BACAH 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI Q4MMJ9_BACCE 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI B7ITN1_BACC2 164 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q2M4U4_9MYCO 168 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ31_9MYCO 168 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ30_MYCFO 168 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ19_9MYCO 168 8 -
LQARLMSQALRKLSGSVSKSNTIAIFINQV B9EBH1_9STAP 164 8 -
LAARMMSQAMRKLAGNLKQANTLLIFINQI RECA_PROVU 167 8 -
LQARLMSQALRKLTGSIKQTNTMVIFINQI Q1ZCX1_9GAMM 168 8 -
LQARLMSQALRKLTAHISKSNCIVIFINQL B7Y4S4_RUMHA 170 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q2M4U7_9MYCO 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCA9 167 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_ENTAG 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ26_MYCAB 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QGG1_9MYCO 167 8 -
LQARLMSQALRKLTGAISKSKAVVIFINQI RECA_SYMTH 168 8 -
LHARLMSQALRKLTGSISKSRCLVIFINQI RECA_RHOCS 176 8 -
LQARLMSQALRKLTGQIKNSNCLVVFINQI RECA_PASMU 167 8 -
LQARLMSQALRKLTGSVKQANCLMIFINQI RECA_HAHCH 165 8 -
LQARLMSQALRKITGALANSGTTAIFINQL A8L6J1_FRASN 166 8 -
LAARMMSQAMRKLAGNLKNSNTLLIFINQI B6WZU4_9ENTR 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ18_9MYCO 168 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI Q5PXP6_LISSE 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_LISWE 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_LISW6 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_LISSE 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI RECA_LISIV 164 8 -
LQARLMSQALRKLSGAINKSKTIAIFINQI Q5S3P5_LISWE 164 8 -
LQARLMSQALRKLTSQIKNANCLVIFINQI RECA_ACTAC 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ22_9MYCO 168 8 -
VQARLMSQALRKLTGTISKSSTIVIFINQI A7H7H5_ANADF 169 8 -
LQARLMSQALRKLTANIKATNCLVIFINQI A7JUT5_PASHA 180 8 -
LQARLMSQALRKLTANIKATNCLVIFINQI RECA_PASHA 180 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL RECA_STRRM 166 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI B8DFS9_LISMO 164 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI RECA_LISMO 164 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI RECA_LISMF 164 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI RECA_LISIN 164 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI Q8G906_LISMO 164 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI Q547E3_LISMO 164 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI Q540Q2_LISIN 164 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI Q4EGT3_LISMO 164 8 -
LQARLMSKALRKLTASIFRSNCMVIFINQI RECA_BARQU 164 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A6AW11_VIBHA 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A7MYT7_VIBHB 172 8 -
LHARLMSQALRKLTGSVSKSKTIVIFINQI A4U369_9PROT 176 8 -
LQARLMSQALRKLAGAINKSNTTAVFINQL B1CBR0_9FIRM 173 8 -
LQARLMSQALRKLTGVVHKMDTTVIFINQI RECA_NITSB 165 8 -
LQARLMSQALRKMTSALNNSGTTAIFINQL RECA_NOCFA 168 8 -
LQARLMSQALRKLTGTIAKSKTVVIFINQI RECA_LEPIC 181 8 -
LQARLMSQALRKLTGTIAKSKTVVIFINQI RECA_LEPIN 181 8 -
VHARLMSQAMRKLTGSINRSGCMVIFINQI A4EKT9_9RHOB 178 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI RECA_ACICA 165 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI RECA_MANSM 167 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A6D4F1_9VIBR 165 8 -
LQARLMSQALRKLTGGLNQTQTTMIFINQL B0RGY9_CLAMS 210 8 -
LQARLMSQALRKLTGGLNQTQTTMIFINQL RECA_CLAM3 167 8 -
LQARLMSQALRKLTGSIKKSNCVAIFINQL RECA_CLOD6 167 8 -
LQARLMSQALRKLSGAVSKSRTALIFINQL RECA_HERA2 166 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI A3XAW9_9RHOB 175 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI Q8GNQ3_LISMO 164 8 -
LQARLMSQALRKMTGVLSNTGTTAIFINQL RECA_SALAI 167 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI A3LE75_PSEAE 165 8 -
LQARLMSQALRKLTGSIKKSNCVAIFINQL B0AAJ2_9CLOT 167 8 -
VQARLMSQAMRKLTGSISRSNCMVIFINQI A9GSY4_9RHOB 178 8 -
LQARLMSQALRKLTGVIGKTNTSIIFINQI A8ZY66_DESOH 166 8 -
LQSRLMSQALRKLTGSISSTNTMMIFINQI Q4FMX8_PELUB 157 8 -
LQARLMSQALRKLTGVVHKMGTTVIFINQI RECA_CAMHC 165 8 -
LQSRLMSQALRKLTGSISSTNTMMIFINQI Q1V252_9RICK 182 8 -
LQARLMSQALRKLSGAVSKSKTIAMFINQI A8VT65_9BACI 164 8 -
LQARLMSQALRKLTGSIKKSNCVAIFINQL B6FZD0_9CLOT 167 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAEQ 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAES 165 8 -
LQARLMSQALRKMTGVLSHTGTTAVFINQL RECA_SALTO 167 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI Q2FHF3_STAA3 140 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAW 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAU 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAT 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAS 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAR 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAN 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAM 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAE 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAC 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAAB 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAA9 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAA2 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAA1 165 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI Q2FZ09_STAA8 140 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI B9CVM8_STACP 165 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCGI 168 8 -
LQARLMSQALRKITGALSHSGTTAIFINQL RECA_ACIC1 167 8 -
LQARLMSQALRKLAGVTSKSKSIVVFINQL B7R8S2_9THEO 164 8 -
LQARLMSQALRKLAGVTSKSKSIVVFINQL RECA_THETN 165 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL A1A272_BIFAA 197 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL A7A8C4_BIFAD 183 8 -
LQARLMSQALRKLTGNIKNTNCLVVFINQI B9CWV3_9PAST 181 8 -
LQARLMSQALRKLSGAISKSNTTAIFINQI RECA_STAHJ 165 8 -
VHARLMSQAMRKLTGSISRTKCTVIFINQI B5IXK8_9RHOB 177 8 -
LQARLMSQALRKLTSVISKSNCVVIFINQL B7BZK5_9FIRM 178 8 -
LQARLMSQALRKLAGTINKTNCVAIFINQL B1QSG2_CLOBU 168 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ29_MYCCH 167 8 -
LQARLMSQALRKLSGSIRKSRTTAVFINQI B2A3V4_NATTJ 164 8 -
LQARLMSQALRKITSALNQSKTTAIFINQL B5G7B0_9ACTO 166 8 -
LQARLMSQALRKVTGNIKNANCMVMFVNQI RECA_CHRSD 167 8 -
LQARLMSQALRKLTGNVKHANCLMVFINQI RECA_MARAV 165 8 -
LQARLLSQAMRKLTGAIKQTNCLVIFINQI B8KSF1_9GAMM 165 8 -
LHARLMSQALRKLTAAISRSNCVVIFINQL A5ZPC8_9FIRM 167 8 -
LQARLMSQALRKLTANIKNANCLCIFINQI RECA_AERHH 165 8 -
LQARLLSQAMRKLTATIKQTNCLVIFINQI B8KI12_9GAMM 165 8 -
LQARLMSQALRKLSGVINKSKTIAIFINQI Q8GNQ2_LISMO 164 8 -
LQARLMSQALRKLTGSISRSSSLVLFINQI A0L826_MAGSM 176 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL B6XTI1_9BIFI 183 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_ALISL 165 8 -
LQARLMSQALRKLTAIISKSNCTVIFINQL B0MJ53_9FIRM 167 8 -
VQARLMSQALRKLTGTISKSATIVIFINQI B4UGJ8_ANASK 169 8 -
LQARLMSQAMRKLTGIIAKSRTAAIFINQI B7B4G1_9FIRM 178 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI Q2C123_9GAMM 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI Q1ZN94_9VIBR 165 8 -
LQARLMSQALRKLAGVTSKSKTIVVFINQL B0K1B8_THEPX 164 8 -
LQARLMSQALRKLAGVTSKSKTIVVFINQL B0K9N2_THEP3 164 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI RECA_CAMJD 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A6B6D9_VIBPA 172 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_VIBPA 165 8 -
LQARLMSQALRKLAGSINKSKCVAIFINQL B1II35_CLOBK 172 8 -
LQARLMSQALRKLAGSINKSKCVAIFINQL B1KWJ3_CLOBM 172 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_VIBAN 165 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ24_MYCCH 167 8 -
LQARLMSQALRKLAGSINKSKCVAIFINQL A5I4H9_CLOBH 169 8 -
LQARLMSQALRKLAGSINKSKCVAIFINQL B1QQ14_CLOBO 172 8 -
LQARLMSQALRKLAGSINKSKCVAIFINQL B1QEE3_CLOBO 172 8 -
LQARLMSQALRKLAGSINKSKCVAIFINQL A7GFZ2_CLOBL 169 8 -
LQARLMSQALRKLAGSINKSKCVAIFINQL A7FVX9_CLOB1 169 8 -
LAARMMSQAMRKLTGNIKNNNVLVIFINQI A4AAD1_9GAMM 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_VIBVY 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI RECA_VIBVU 165 8 -
LQARLMSQALRKLTGGLSQTNTTMIFINQL A4AHJ3_9ACTN 167 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI B8K904_VIBPA 180 8 -
VHARLMSQAMRKLTGSINRSGCMVVFINQI Q28QV9_JANSC 178 8 -
LQARLMSQALRKLTGSISKSNTTVIFINQL RECA_SYNAS 168 8 -
LQARLMSQALRKLSGAISKSNCTAVFINQI B9DPC5_STACA 165 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ20_9MYCO 168 8 -
LQARMLSQAMRKLTGNLKQSNCMAIFINQI A3UV42_VIBSP 165 8 -
VQARLMSQALRKLTGTIAKSATIVIFINQI B8J9N8_9DELT 169 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ27_9MYCO 168 8 -
LQARLMSQALRKLSGSLSRSGTTAIFINQL RECA_RUBXD 165 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ34_9MYCO 168 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ32_9MYCO 168 8 -
SQARLMSQALRKLTASINRTNCITVFINQI RECA_RICB8 166 8 -
SQARLMSQALRKLTASINRTNCITVFINQI RECA_RICBR 166 8 -
LQARLMSQALRKLTAVIGKSRTVAIFINQI B1I314_DESAP 165 8 -
LQARLMSQALRKLSGAINKSKAIAIFINQI B1SQM1_9BACI 98 8 -
LQARLMSQALRKLTSSINKSKCVTIFINQL A5N856_CLOK5 168 8 -
LQARLMSQALRKLTSSINKSKCVTIFINQL B9E1L6_CLOKL 168 8 -
LQARLMSQALRKLTANIKNANCLCIFINQI RECA_AERSA 165 8 -
LQARLMSQALRKLTANIKRTNTTVIFINQI RECA_NITEC 166 8 -
LQARLMSQALRKLSGAISKSNTTAVFINQI RECA_STAS1 165 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI Q1V5N0_VIBAL 165 8 -
LQARLMSQALRKITGNIKNANCLVIFINQI B3PJB8_CELJU 170 8 -
VQARLMSQALRKLTAAIHKMNTTVVFINQI A6DBB8_9PROT 165 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ17_9MYCO 168 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI A3YK12_CAMJE 165 8 -
LQARLMSQALRKLSGATNKSKTIVIFINQI RECA_EXIS2 164 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI RECA_CAMJR 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI RECA_CAMJJ 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI RECA_CAMJE 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI RECA_CAMJ8 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI B5QFR3_CAMJE 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI A5KEY5_CAMJE 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI A3ZFZ0_CAMJE 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI A3ZD29_CAMJE 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI A3YT62_CAMJE 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI Q4HE44_CAMCO 165 8 -
LQARLMSQALRKMTGALNAAGTTAIFINQL A5X9E4_PROAC 167 8 -
LQSRLMSQALRKLTGSISNTNTMMIFINQI A4GJZ1_9BACT 182 8 -
SQARLMSQALRKLTASINRTNCITVFINQI A8GTM6_RICRS 185 8 -
SQARLMSQALRKLTASINRTNCITVFINQI B0BV65_RICRO 185 8 -
LQARLMSQALRKLTAVISKSNCIVIFINQL A9KLQ6_CLOPH 167 8 -
SQARLMSQALRKLTASINRTNCITVFINQI RECA_RICFE 166 8 -
SQARLMSQALRKLTASINRTNCITVFINQI RECA_RICTY 166 8 -
SQARLMSQALRKLTASINRTNCITVFINQI RECA_RICPR 166 8 -
SQARLMSQALRKLTASINRTNCITVFINQI RECA_RICM5 166 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ23_MYCPR 168 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL B1S8G9_9BIFI 249 8 -
LQARLMSQALRKLTGTIAKSKTVVVFINQI Q04T44_LEPBJ 181 8 -
LQARLMSQALRKLTGTIAKSKTVVVFINQI Q051G6_LEPBL 181 8 -
LQARLLSQAMRKLTGAIKQTNCLVIFINQI A0Z6J8_9GAMM 165 8 -
LQARLMSQALRKLTANIKRTNTMVIFINQI RECA_NITEU 166 8 -
VQARLLSQAMRKLTGSIKNANCLVIFINQI A6W1Q4_MARMS 168 8 -
LQARLMSQALRKLAGIISKSRTVAIFINQL Q2RJJ6_MOOTA 170 8 -
LQARLMSQALRKITGALANSGTTAIFINQL A8L0T0_FRASN 166 8 -
LQARLMSQALRKITGALSNSGTTAIFINQL RECA_MYCSJ 168 8 -
LQARLMSQALRKITGALSNSGTTAIFINQL RECA_MYCSS 168 8 -
LQARLMSQALRKITGALSNSGTTAIFINQL RECA_MYCSK 168 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI Q83TZ0_CAMLA 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI Q845T1_CAMLA 165 8 -
LQARLMSQALRKLSGSINKTKTIAVFINQI Q6KCJ2_9ENTE 165 8 -
LQARLLSQAMRKLTAAIKQTNCLVIFINQI B7RWK5_9GAMM 165 8 -
LQARLMSQALRKMTGALNAAGTTAIFINQL Q5IV60_PROAC 167 8 -
SQARLMSQALRKLTASISRTNCIAVFINQI RECA_RICCK 166 8 -
SQARLMSQALRKLTASINRTNCITVFINQI A8GPU6_RICAH 185 8 -
LQARLMSQALRKIAGALNQTKTTAIFINQL Q47RS6_THEFY 611 8 -
LQARLMSQALRKLTSALYNAKTTAIFINQL RECA_SACEN 167 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI Q1Z485_PHOPR 165 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q2M4U6_9MYCO 168 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q5QJ21_9MYCO 168 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL B3DR86_BIFLD 204 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL RECA_BIFLO 183 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL RECA_BIFBR 183 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL B9AW73_BIFBR 205 8 -
LQARLMSQALRKMTGALAQAGTTAIFINQL B7GQG8_BIFLI 204 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL Q2M4U5_9MYCO 168 8 -
LQARLMSQALRKMTGALNAAGTTAIFINQL Q2QJS7_PROAC 167 8 -
LQARLMSQALRKMTGALNAAGTTAIFINQL RECA_PROAC 167 8 -
LQARLMSQALRKLAGSLSKSNTTCIFINQL B9CKI0_9ACTN 180 8 -
LQARLMSQALRKLAGNIKRSNTLVIFINQI A8PQD9_9COXI 168 8 -
LQARLMSQALRKLSGSINKTKTIAVFINQI Q6KCJ0_9ENTE 165 8 -
LQARLMSQALRKLSGSINKTKTIAVFINQI Q6KCJ1_9ENTE 165 8 -
LQARLMSQALRKLSGSINKTKTIAVFINQI Q6KCK1_9ENTE 165 8 -
LQARLMSQALRKLSGSINKTKTIAVFINQI Q6KCJ4_9ENTE 165 8 -
SQARLMSQALRKLTASINRTNCIAVFINQI Q7P9T0_RICSI 166 8 -
VQARLMSQALRKLTAAIHKMNTTVVFINQI B9L7U2_9PROT 165 8 -
LQSRLMSQALRKLTSSISNTNTMMIFINQI B6BSI6_9RICK 182 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCMM 167 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI B9KEN1_CAMLA 165 8 -
LQARLLSQALRKITASVSRSNCVVVFINQI Q2GDN2_NEOSM 161 8 -
LQARLMSQALRKLAGITSKTKTTVIFINQL B9MQY3_ANATH 166 8 -
LQARLMSQALRKLTAQIKSSNCLVVFINQI A6VKZ3_ACTSZ 175 8 -
LQARLMSQALRKLTAVISKSNCIVIFINQL A8RNZ1_9CLOT 190 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI RECA_PSYWF 166 8 -
LQARLMSQALRKVTGVLHKMNTTVIFINQI RECA_WOLSU 167 8 -
LQARLMSQALRKLTGTVSKSGTCLIFINQI Q1IV37_ACIBL 169 8 -
LQARLMSQALRKLAGVTSKTKTTVIFINQL A4XLD6_CALS8 166 8 -
LQARLMSQALRKLTGVVHKMGTTVVFINQI RECA_CAMFE 165 8 -
LQARLMSQALRKLTGVVHKMGTTVVFINQI RECA_CAMFF 165 8 -
VQARLMSQALRKLTGTISKSSTIVIFINQI Q2IGM0_ANADE 169 8 -
SQARLMSQALRKLTASINRTNCITVFINQI RECA_RICCN 166 8 -
LQARLMSQALRKLAGVVHKMNTTVIFINQI B9D2D4_WOLRE 165 8 -
LQARMLSQAMRKLTGNLKQSNCMAIFINQI RECA_VIBF1 165 8 -
LQARMLSQAMRKLTGNLKQSNCMAIFINQI RECA_VIBFM 165 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCA1 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCPA 167 8 -
LQARLMSQALRKLTGIISKSKATVIFINQI A5KTF3_9BACT 177 8 -
LQARLMSQALRKMTGALYNSGTTAIFINQL RECA_CORGB 178 8 -
LQARLMSQALRKMTGALYNSGTTAIFINQL RECA_CORGL 178 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCVP 168 8 -
LLARLMSQALRKLAGSIAKTNCIVIFINQL A6NW33_9BACE 182 8 -
LQARMLSQAMRKLTGNLKNANCMCIFINQI RECA_PHOPR 165 8 -
LQARLMSQALRKLSGTINKTKTIAIFINQI Q6KCJ9_9ENTE 165 8 -
LQARLMSQALRKLSGAISKSNTTAVFINQI A7KJJ5_STAXY 165 8 -
LQARLMSQALRKMTGALNAAGTTAIFINQL Q5IV56_PROAC 167 8 -
QQARLMSQAMRKLTPVASSNNCIVIFINQI B7ATW2_9BACE 167 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI Q6KCJ8_9ENTE 165 8 -
LQARLMSQALRKLTGIVSKSKTIVVFINQI A4J5T8_DESRM 164 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI B7H1V4_ACIB3 165 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI RECA_ACIBY 165 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI RECA_ACIBT 165 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI RECA_ACIBS 165 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI RECA_ACIBC 165 8 -
LQARLMSQALRELTGIVHKMNTTVIFINQI Q8VLF3_CAMLA 165 8 -
LQARLMSQALRKLTGIVHKMNTTVIFINQI Q4HR02_CAMUP 165 8 -
LQARLMSQALRKITGNAKRSNCMVIFINQI B7I9U0_ACIB5 165 8 -
LQARLMSQALRKLTGVISKSNCTVIFINQL B0S1D5_FINM2 169 8 -
LQARLMSQALRKLTGILSKMKTTVIFINQI A7ZFN0_CAMC1 180 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI RECA_ENTFA 165 8 -
VQARLLSQAMRKLTGSIKNANCLVVFINQI A3YGX8_9GAMM 90 8 -
LQARLMSQALRKLSGAISKSRVVVIFLNQL RECA_ROSCS 168 8 -
LQARLMSQALRKLTGVISKSKTVAIFINQL B5YEC6_DICT6 163 8 -
LQARMLSQAMRKLTGNLKTSNTMCIFINQI A6FHA2_9GAMM 165 8 -
LQARLMSQALRKLTGAAKNANCMIVFINQI A3YH37_9GAMM 171 8 -
LQARLMSQALRKLTGVISKSKTVAIFINQL B8E2U1_9BACT 163 8 -
LQARLMSQALRKITGNAKRSNCMVLFINQI RECA_PSYA2 166 8 -
LQARLMSQALRKITGNAKRSNCMVLFINQI RECA_PSYCK 166 8 -
MQARLMSQALRKLTSSISRSKCILVFINQM B6F2Z4_LIBAS 165 8 -
LQARLMSQALRKLTAAINRSNTLVIFINQI RECA_BDEBA 176 8 -
LQARLMSQALRKLVSSISKSRTCVIFINQI RECA_SYNFM 168 8 -
LQARLMSQALRELTGIVHKMNTTVIFINQI RECA_CAMLA 165 8 -
LQARLMSQALRKITGALSATGTTAIFINQL A7BD53_9ACTO 176 8 -
LQARLMSQALRKITGRLSHTNTTAIFINQL B2GKH2_KOCRD 166 8 -
LQARLMSQALRKLTAILHKTNTTVIFINQI RECA_SULNB 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCUA 167 8 -
LQARLMSQAMRKFAGVLNRSNTVLIFINQI RECA_DESPS 169 8 -
LQARLMSQALRKLSGTINKTKTIALFINQI RECA_LACBA 165 8 -
LQARLMSQALRKLTAHIGKSNACVLFINQI Q0AXJ0_SYNWW 170 8 -
LHARLMSQALRKLTAVVSKTNCVVIFINQL A7VB17_9CLOT 168 8 -
LQARLMSQALRKLSGTLNKTKTIALFINQI Q6KCK4_9LACO 165 8 -
LQARLMSQALRKMTGALYNSGTTAIFINQL RECA_CORDI 177 8 -
LQARLMSQALRKMTGALSNSGTTAIFINQL B8ZQT5_MYCLE 167 8 -
LQARLMSQALRKMTGALSNSGTTAIFINQL RECA_MYCLE 167 8 -
LQARLMSQALRKLSGAISKSRAVVIFLNQL RECA_ROSS1 168 8 -
LQARLMSQALRKLTGVVSKSKTCCLFINQI RECA_HELMI 168 8 -
LQARLMSQALRKLSGTLNKTKTIALFINQI Q6KC82_LACPL 165 8 -
LQARLMSQALRKLSGTLNKTKTIALFINQI RECA_LACPL 165 8 -
LQARLMSQALRKLSGTLNKTKTIALFINQI RECA_LACPE 165 8 -
LQARLMSQALRKLSGTLNKTKTIALFINQI Q6KCK2_LACPL 165 8 -
LAARMMSQAMRKITGNLKNSNTMCIFINQI A4XPD2_PSEMY 165 8 -
LAARMMSQAMRKITGNLKNSNTMCIFINQI RECA_PSEOL 165 8 -
LQARLMSQALRKMTSALYQTGTTAIFINQL RECA_CORU7 175 8 -
LHARLMSQALRKLTGTISKTGCCCIFINQL A6EIR5_9SPHI 167 8 -
LQARLMSQALRKLTGAISKSSSVCIFINQL RECA_CHLP8 180 8 -
LQARLMSQALRKLTGILSKMKTTVIFINQI A7H0M6_CAMC5 180 8 -
LQARLMSQALRKLTAAISKSQTAVIFINQI B5YJG1_THEYD 166 8 -
LQARLMSQALRKMTGALYQTGTTAIFINQL RECA_CORJK 175 8 -
VQARLMSQALRKLTGSVNKSRTCLIFINQI Q02AB1_SOLUE 167 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFIKQI RECA_VIBNA 165 8 -
LQARLMSQALRRLTGIISKSNTTVIFINQL B6W918_9FIRM 169 8 -
MQARLMSQALRKLSGAISKSRTVVIFINQL B9LCN0_9CHLR 168 8 -
MQARLMSQALRKLSGAISKSRTVVIFINQL O52394 168 8 -
LQARLMSQALRKLTGTISKSNTTVIFINQI RECA_LEPME 178 8 -
LQARLMSQALRKMTGALYNSGTTAIFINQL RECA_COREF 176 8 -
LQARLMSQALRKMTGALAQANTTAIFINQL B2E872_BIFAN 184 8 -
LQARLMSQALRKMTGALAQANTTAIFINQL B8DT97_BIFAN 184 8 -
LQARLMSQALRKITGNIGKSGCTVIFINQL RECA_NOSP7 169 8 -
LQARLMSQALRKITSGLNQTGTTAIFINQL RECA_TROW8 169 8 -
LQARLMSQALRKITSGLNQTGTTAIFINQL RECA_TROWT 169 8 -
LQARMLSQAMRKITGNLKQSNCMCIFINQI A5L337_9GAMM 167 8 -
LQARLMSQALRKLTSAISKTNTTCIFINQL B5D1J8_9BACE 184 8 -
LQARLMSQALRKLTPVISKSNCVVIFINQL A6BJF8_9FIRM 167 8 -
LQARLMSQALRKLTGSVSRGRTLVIFINQL A6GK08_9DELT 177 8 -
LQARLMSQALRKLTPVISKSNCVVIFINQL B0G577_9FIRM 168 8 -
LQARLMSQALRKLSGTINKTKTIALFINQI Q6KCI8_9ENTE 165 8 -
VQARLMSQALRKLTGAVSRSGTCIIFINQI Q1DCC5_MYXXD 168 8 -
VQARLMSQALRKLTGAVSRSGTCIIFINQI REC1_MYXXA 168 8 -
VQARLMSKALRKVTGLLSKMNCTVIFINQI RECA_ARCB4 165 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI A4KP48_FRATU 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRATW 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRATT 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRATO 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRATN 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRATM 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRATH 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRATF 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI RECA_FRAT1 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI B4AS14_FRANO 164 8 -
LQARLMSQALRKLTGTTSRSQCLLMFINQI A9GC15_SORC5 172 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI A7YR40_FRATU 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI A7JFJ7_FRANO 164 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI A7JEW1_FRATT 164 8 -
MQARLMSQALRKLSGAISKSRAVVIFINQL B8GAQ9_9CHLR 168 8 -
LQARLMSQALRKLTANIKRSNTLVMFINQI RECA_FRAP2 164 8 -
LQARLMSQALRKLSGSINKTKTIALFINQI Q6KCI7_9ENTE 165 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI A4N0Z4_HAEIN 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI RECA_HAEIN 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI RECA_HAEIG 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI RECA_HAEIE 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI RECA_HAEI8 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI A4NW53_HAEIN 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI A4NQP5_HAEIN 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI A4NNY3_HAEIN 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI A4NIB3_HAEIN 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI A4NCS2_HAEIN 167 8 -
LQARLMSQALRKLTGQIKNANCLVVFINQI A4N6U0_HAEIN 167 8 -
LQARLMSQALRKMTGALYNSGTTAIFINQL RECA_CORPS 177 8 -
LQARLMSHALRKITGVLHKMNATLIFINQI RECA_HELHP 166 8 -
LQARLMSQALRKLTGAISKSSTVCIFINQL A1BIQ4_CHLPD 178 8 -
LQARLMSQALRKLTPVISKSNCVVIFINQL A7B2G7_RUMGN 166 8 -
LQARLMSQALRKLTSNISKSKTSIVFINQL B1GYL2_UNCTG 167 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI Q6KCI5_9ENTE 165 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI Q6KCJ7_9ENTE 165 8 -
LHARLMSQALRKLTGSISKTNCTVIFINQL A3XGX2_9FLAO 168 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI RECA_ENTHR 165 8 -
LAARMMSQAMRKLTSNLKNANTLLIFINQI RECA_BAUCH 167 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI Q6KCI6_9ENTE 165 8 -
LQARLMSQALRKITGNIGKSGCTVIFINQL A0ZKA5_NODSP 169 8 -
QHARLMSQALRKLTGIMNKTGCTVIFINQL A5Z6J3_9FIRM 205 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI Q3Y1B9_ENTFC 165 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI RECA_ENTFC 165 8 -
LQARLMSQALRKLTGAISKSSTVCIFINQL RECA_CHLCH 180 8 -
LAARMMSQAMRKLAGNLKNANTLLIFINQI RECA_WIGBR 167 8 -
LQARLMSQALRKLTGTISKSSTTVIFINQI RECA_LEPBA 178 8 -
LQARLMSQALRKLTGTISKSSTTVIFINQI RECA_LEPBP 178 8 -
LQARLMSQALRKLSGTINKTKTVAIFINQI Q1WT13_LACS1 176 8 -
LQARMLFQAMRKLTCNIKQSNCMCIFINQI A8T9B8_9VIBR 165 8 -
VQARLMSQALRKLTGVVSRNQTLVVFINQI B8J6W0_9DELT 141 8 -
LQARLMSQALRKLSGTISKTKTIAIFINQI RECA_LACAC 166 8 -
LQARLMSQALRKLTPVISKSNCVVIFINQL B7BJM4_9CLOT 167 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI Q6KCI9_9ENTE 165 8 -
VQARLMSQALRKLTGVVSRNQTLVVFINQI B4UDA1_ANASK 168 8 -
LQARLMSQALRKLTGVVSKFNCTVIFINQL B0NZS5_9CLOT 167 8 -
LQARLMSQALRKLTPVISKSNCVVIFINQL B0ND63_EUBSP 167 8 -
LQARLMSQAMRKLSGAISKSKTVCIFINQI B8CXC0_9FIRM 169 8 -
LQARLMSQALRKLAGSLSKSNTTCIFINQL B6GBT7_9ACTN 181 8 -
LQARLMSQALRKLTPVISKSNCVVIFINQL B5CR08_9FIRM 178 8 -
LQARLMSQALRKLTGAISKSSSVCLFINQL O52393 179 8 -
LQARLMSQALRKLTAAINKTNTTCIFINQL A7ACC2_9PORP 184 8 -
LQARLMSQALRKLTAAINKTNTTCIFINQL B7B7E3_9PORP 184 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI RECA_ENTMU 165 8 -
LQARLMSQALRKLTGAISKSSAVCIFINQL RECA_CHLL2 180 8 -
LQARLMSQALRKLTSTISKTNTTCIFINQL B9ANW3_9BACT 176 8 -
LHARLMSQALRKLTGTISKTKCTVIFINQL A4BXB3_9FLAO 170 8 -
LQARLMSQALRKLVASVSKTNCTIIFINQI B3CT01_ORITI 163 8 -
LQARLMSQALRKITGNIGKSGCTVIFINQL RECA_ANASP 169 8 -
LQARLMSQALRKITGNIGKSGCTVIFINQL RECA_ANAVA 169 8 -
LQARLMSQALRKLAGAISKSNCVAIFINQL A7VTT9_9CLOT 184 8 -
LQARLMSQALRKLTSAISKTNTTCIFINQL A6L2X2_BACV8 182 8 -
LQARLMSQALRKLTSAISKTNTTCIFINQL B6W2A9_9BACE 182 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL B5IPP8_9CHRO 205 8 -
LQARLLSHALRKLTSVVSKANCILVFINQI B9KHJ1_ANAMF 174 8 -
LQARLMSQALRKLTPVISKSNCVVIFINQL B6FS94_9CLOT 174 8 -
LQARLMSQALRKLSGEINKTKTIAIFINQI B3XRC0_LACRE 165 8 -
LQARLMSQALRKLSGEINKTKTIAIFINQI RECA_LACRJ 165 8 -
LQARLMSQALRKLSGEINKTKTIAIFINQI RECA_LACRD 165 8 -
LQARLMSQALRKLSGTINKTKTIALFINQI RECA_LACSS 166 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL Q05QA7_9SYNE 179 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_SYNPW 179 8 -
AQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_SYNS3 179 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL A3YUM4_9SYNE 187 8 -
LHARLMSQALRKLTGSISKTNCTVIFINQL A6ELL5_9BACT 170 8 -
LQARLMSQALRKLSGSINKTKTIAIFINQI RECA_ENTGA 165 8 -
LQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_SYNE7 171 8 -
LQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_SYNP6 171 8 -
LQARLMSQALRKLAGSLAKSNTTCIFINQL B6G4X5_9ACTN 181 8 -
LQARLMSQALRKITGRLSQTKTTAIFINQL B8HG89_9MICC 167 8 -
LQARLMSQALRKITGRLSQTKTTAIFINQL RECA_ARTAT 167 8 -
LHARLMSQALRKLTGSISKTHCTVIFINQL A4ANZ6_9FLAO 188 8 -
LQARLMSQALRKLVASVSKTNCTIIFINQI A5CCL6_ORITB 163 8 -
LQARLMSQALRKLTGAISKSSSVCIFINQL Q3B668_PELLD 178 8 -
LQARLLSHALRKLTSVVSKANCILVFINQI RECA_ANAMM 174 8 -
LQARLMSQALRKITSNISKSGSTVIFLNQL B0C5Y5_ACAM1 169 8 -
LQARLLSHALRKLTSIVSKANCILIFINQI RECA_EHRRG 171 8 -
LQARLLSHALRKLTSIVSKANCILIFINQI RECA_EHRRW 171 8 -
LQARLMSQALRKLTSAVSKTRTTCIFINQL Q5LG39_BACFN 153 8 -
LQARLMSQALRKLTSAVSKTRTTCIFINQL RECA_BACFR 153 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL B1X512_PAUCH 174 8 -
LQARMLSQAMRKLTGNLKQSNCMCIFINQI A9M4P2_9VIBR 180 8 -
LQARLMSQALRKLTAAVSKTRTTCIFINQL A7VAG0_BACUN 180 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI RECA_HELAH 167 8 -
LQARLMSQALRKLTAAINKTNTTCIFINQL A6LBZ5_PARD8 185 8 -
LQARLMSQALRKLTAVANRTNTCLIFINQI A8DJT2_9BACT 168 8 -
LQARLMSQALRKITSNIAKSGSTVIFLNQL A8ZPF7_ACAM1 169 8 -
LQARLMSQALRKLAGTINRTKTALIFINQI Q2S2C8_SALRD 169 8 -
LHARLMSQALRKLTASISKTHCTVIFINQL A4CHW1_9FLAO 168 8 -
LHARLMSQALRKLTGTISKTNCTVIFINQL A2TYC4_9FLAO 170 8 -
LQARLMSQALRKLTSAISKTNTTCIFINQL B3JNC6_9BACE 183 8 -
VQARLMSQALRKLTAVVSRNQSLVVFINQI A7HGT3_ANADF 168 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL A3Z8Y2_9SYNE 175 8 -
AQARLMSQAMRKITGNIGKSGCTVIFLNQL A4CSK9_SYNPV 179 8 -
LQARLMSQALRKLTAAVSKTRTTCIFINQL A5ZGP0_9BACE 180 8 -
LQARLMSQALRKITGRLSQTKTTAIFINQL A9WQ43_RENSM 202 8 -
LHARLMSQALRKLTSSISKTNCTVIFINQL A0M6E4_GRAFK 170 8 -
LQARLMSQALRKLSGTISKTKTIAIFINQI A8YUB7_LACH4 166 8 -
LQARLMSQALRKITSNIAKSGSTVIFLNQL A8ZLV5_ACAM1 169 8 -
VQARLMSQALRKLTGAVSRSGTCIIFINQI Q09CN8_STIAU 141 8 -
LQARLMSQALRKITGRLSQTKTTAIFINQL B0BKA0_9MICC 167 8 -
LQARLMSQALRKLSGTIAKTKTIAIFINQI RECA_LACDA 166 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRPG 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRPC 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRPB 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRP8 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRP6 179 8 -
LQARLMSQALRKLSGTIAKTKTIAIFINQI RECA_LACDB 166 8 -
LQARLMSQALRKLTSAISKSNTTVLFINQI A3EWF7_9BACT 170 8 -
LQARLMSQAMRKLASLLQRTNTAIIFINQL Q1NP94_9DELT 168 8 -
LQARLMSQALRKLTSAVSKTRTTCIFINQL B0NNH2_BACSE 180 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRMU 179 8 -
LQARLMSQALRKLTSAVSKTRTTCIFINQL B7AIA5_9BACE 180 8 -
LQARLMSQALRKLTGTVSKTRTTCIFINQL RECA_BACTN 166 8 -
LQARLMSQALRKLTPVISKSNCIVIFINQL A5KKH5_9FIRM 168 8 -
LQARLMSQALRKLTGAISKSSCVCIFINQL Q0YRU2_9CHLB 179 8 -
LQARLMSQALRKLAGSLSKSNTTCIFINQL A4EC83_9ACTN 159 8 -
LQARLMSQALRKITSNICKSGSTVIFLNQL B0CCZ6_ACAM1 169 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_SYNPX 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL A5LEG8_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL RECA_STRR6 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL RECA_STRPS 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL RECA_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL RECA_STRPI 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL RECA_STRP4 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL RECA_STRP2 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL B8ZNU7_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL B2E6T2_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL B2E1Y3_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL B2DVL7_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL B2DQY6_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL B2DKH8_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL B1S2Q9_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL A5MWD5_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL A5MPK3_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL A5MHL6_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL A5MA70_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL A5M2X0_STRPN 179 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL A5LTW1_STRPN 179 8 -
VQARLMSQALRKLTGVVSRNQTIVVFINQI Q2IFM8_ANADE 141 8 -
LQARLMSQALRKLSGTISKTKTIAIFINQI A4UAE2_LACHE 166 8 -
LHARLMSQALRKLTAVVSKTNCVVIFINQL A8SPJ7_9FIRM 175 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL B9DW65_STRUB 179 8 -
LQARLMSQALRKLTSTISKTNTTCIFINQL B6YQ33_AZOPC 180 8 -
LQARLMSQALRKITGRLSQTKTTAIFINQL RECA_ARTS2 167 8 -
LQARLLSHALRKLTSIVSKANCVLIFINQI Q40IG8_EHRCH 171 8 -
LQARLLSHALRKLTSIVSKANCVLIFINQI RECA_EHRCR 171 8 -
LQARLMSQALRKLSGSINKTKTIALFINQI B3WCM1_LACCB 166 8 -
LQARLMSQALRKLSGSINKTKTIALFINQI Q03AQ0_LACC3 166 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI RECA_HELPH 167 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI RECA_HELPS 167 8 -
LQARLMSQALRKLTSAISKSNTTVLFINQI B6ANE8_9BACT 170 8 -
LQARLMSQALRKLTAAVSKTRTTCIFINQL B3CCX8_9BACE 180 8 -
LHARLMSQALRKMTGTISKTNCTVIFINQL Q26HA5_9BACT 140 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL B1SCW6_9STRE 187 8 -
LHARLMSQALRKLTGTISKTKCTVFFINQL A6H1S7_FLAPJ 168 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI RECA_HELPY 167 8 -
LQARLMSQALRKITGNIGKTGCMVIFLNQL RECA_GLOVI 182 8 -
LQARLMSQALRKLSGNISKTKTIAVFINQI Q042C2_LACGA 166 8 -
LQARLMSQALRKLSGNISKTKTIAVFINQI RECA_LACJO 166 8 -
AQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROM1 182 8 -
AQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROMT 182 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL Q3CZB3_STRAG 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRA5 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRA3 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL Q9F5P5_STRAG 140 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL Q3JYN1_STRA1 140 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL Q3DQA1_STRAG 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL Q3DGG0_STRAG 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL Q3DA70_STRAG 179 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI RECA_HELPG 167 8 -
LQARLMSQALRKLTAAVSKTRTTCIFINQL B6WDW6_9BACE 180 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROMA 184 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STREM 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRPM 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRP1 179 8 -
AQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_SYNSC 177 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL B9NYQ8_PROMA 173 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROMS 173 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROM9 173 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROM2 173 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROM0 173 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL Q1PK73_PROMA 173 8 -
LQARLMSQALRKLTAAVSKTRTTCIFINQL A7M5K6_BACOV 180 8 -
LHARLMSQALRKLAGIISKSNTTVVFINQL A8SMT5_9FIRM 178 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROM5 178 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROMP 178 8 -
LQARLMSQALRKITGNIGKSGCTVIFLNQL B5W6W4_SPIMA 169 8 -
LQARLMSQALRKLTGAINKTGCSCIFINQL A3HWX3_9SPHI 167 8 -
LQARLLSHALRKLTSIVSKANCVLIFINQI RECA_EHRCJ 171 8 -
LQARLMSQALRKLTGAISKSSCVCIFINQL B4SFE4_PELPB 178 8 -
LQARMMSQALRKLSGSINKTKTIALFINQI Q03EQ5_PEDPA 165 8 -
LHARLMSQALRKLTGSISKTKCTVIFINQL A3U6B8_9FLAO 170 8 -
LQARMMSQAMRKLGASINKTKTIAIFINQL O85502 179 8 -
LQARLMSQAMRKLTSVIGKTNTVCVFINQL A8S787_9FIRM 181 8 -
SQARLMSKAMRKIAGNIGRSGCLVIFLNQL RECA_SYNY3 168 8 -
LQARLMSQALRKITGNIGKTGCIVIFLNQL B8HR52_9CHRO 170 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRT1 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRTD 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRT2 179 8 -
LHARLMSQALRKLTASISKTNCTVIFINQL A9DT53_9FLAO 170 8 -
AQARLMSQAMRKITGNIGKSGCTVIFLNQL A5GVV5_SYNR3 173 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL A1KM75_MYCBP 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCTU 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL RECA_MYCBO 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL A5U689_MYCTA 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL A4KK14_MYCTU 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL A2VL74_MYCTU 167 8 -
LQARLMSQALRKMTGALNNSGTTAIFINQL A1QV11_MYCTF 167 8 -
LQARLMSQALRKLTACISKSRTSVIFINQI Q1PYI7_9BACT 173 8 -
VQARLMSKALRKLTGVISKMNCTVIFINQI B6BH95_9PROT 165 8 -
LQARLMSQALRKIAGNVSKTGSIVLFLNQL Q2JK85_SYNJB 164 8 -
LQARLMSQALRKITGNIGRTGCTVVFLNQL B0C288_ACAM1 170 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRSV 179 8 -
LQARLMSQALRKLTSSISKTKTVCIFINQL B0MSV9_9BACT 171 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI RECA_HELPJ 167 8 -
LQARLLSHGLRKLTSAVSKANCILIFINQI RECA_WOLPM 172 8 -
LQARLMSKALRKIAGNIGKSGCVVIFLNQL B7JZS9_CYAP8 169 8 -
LQARLLSHALRKLTSVVSKANCILVFINQI Q2EFY1_ANACE 172 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI Q8VLM8_HELPY 167 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROM3 184 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROMM 184 8 -
LQARLMSHALRKITGVLHKMNTTLIFINQI RECA_HELP2 167 8 -
LHARLMSQALRKLTGTISKTNCTVFFINQL A5FLA2_FLAJ1 168 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRGC 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRP3 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRPF 179 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRPD 179 8 -
LQARMMSQAMRKLGASINKTKTVAIFINQL A4VSE7_STRSY 118 8 -
LQARMMSQAMRKLGASINKTKTVAIFINQL Q9KWG8_STRSU 140 8 -
LQARMMSQAMRKLGASINKTKTVAIFINQL A4VYN5_STRS2 180 8 -
LQARLMSQALRKLTGAISKSSCSCIFINQL A4SD03_PROVI 179 8 -
LQARLMSQALRKITGNIGKSGCTVIFLNQL RECA_SPIPL 169 8 -
LQARLMSQALRKLTSSIGQTRTAVIFINQL A8CPQ2_9CHLR 166 8 -
LQARLMSQALRKLTASIGQTRTAVIFINQL Q3Z648_DEHE1 166 8 -
LHARLMSQALRKLTGSISKTNCTVIFINQL A2TR45_9FLAO 168 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRP9 179 8 -
LQARLMSQALRKLTGAISKSNCVAIFINQL RECA_CHLT3 179 8 -
LQARLMSQALRKLTANIKRSNTLVIFINQI A7JPI1_FRANO 164 8 -
GQARLMSHALRKLTGTIHKSRTAVIFINQI B8DP00_DESVM 173 8 -
LHARLMSQALRKLTGTIHKTNCTVFFINQL A3J3B9_9FLAO 168 8 -
LQARLMSKALRKIAGNIGKSGCVVIFLNQL RECA_CYAA5 169 8 -
LQARLMSKGLRKLTGNLNKYKTTMIFINQI A5TXF8_FUSNP 180 8 -
LQARMMMQAMHKLTASINKTKTIAIFINQL RECA_STRAG 179 8 -
LQARLMSKGLRKLTGNLNKYKTTMIFINQI RECA_FUSNN 180 8 -
LHARLMSQALRKLTASISKTNCTMVFINQL A8UIA5_9FLAO 168 8 -
LQARLMSQALRKLTAIIGKSNCMIIFINQI RECA_TREDE 178 8 -
GQARLMSHALRKLTGTIHKSRTAVIFINQI RECA_DESVH 173 8 -
GQARLMSHALRKLTGTIHKSRTAVIFINQI RECA_DESVV 173 8 -
LQARLLSHGLRKLTSVVSKANCILIFINQI B6Y6M6_9RICK 172 8 -
LQARLLSHGLRKLTSVVSKANCILIFINQI RECA_WOLPP 172 8 -
LQARLMSQALRKLTASIGQTRTAVVFINQL A5FPE2_DEHSB 166 8 -
LQARLMSQALRKLTASIGQTRTAVVFINQL Q3ZW84_DEHSC 166 8 -
LQARLMSQALRKIAGNVSKTGSIVLFLNQL Q2JVF7_SYNJA 164 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRPZ 179 8 -
LQARLMSKALRKIAGNIGKSGCVVIFLNQL A3IPB2_9CHRO 169 8 -
LQARLMSQALRKLTGAISKSSAVVIFINQL B3ENK1_CHLPB 178 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_PROM4 184 8 -
LQARLMSQALRKLTGAINKTGCCCIFINQL RECA_CYTH3 174 8 -
SQARLMSQAMRKITGNIGKSGCTVIFLNQL Q05ZF3_9SYNE 179 8 -
AQARLMSQAMRKITGNIGKSGCTVIFLNQL RECA_SYNS9 179 8 -
LQARLMSQALRKLSGEINKTKTIAIFINQI RECA_LACF3 165 8 -
LQARLMSKALRKIAGNIGKSGCVVIFLNQL Q4BUQ0_CROWT 169 8 -
LHARLMSQALRKLTGSVSKSKTIVIFINQI RECA_AQUMA 163 8 -
LQARLMSQALRKLTSTISKTNTTCIFINQL RECA_PRERU 175 8 -
LQARLMSQALRKITSNICKSGSTVIFLNQL A8ZKA1_ACAM1 169 8 -
GHARLMSHAMRRLTGTIHKSRTSVIFINQI B8J369_DESDE 173 8 -
LQARLMSQALRKITSNICKSGSTVIFLNQL A8ZP31_ACAM1 169 8 -
LQARMMSQAMRKMSGVISKSNVVAIFINQI RECA_ACHLI 166 8 -
GHARLMSHAMRRLTGTIHKSRTSVIFINQI B6WXJ7_9DELT 173 8 -
LQARLMSQALRKLAGTLNRTGTIAIFINQI Q03YM4_LEUMM 178 8 -
LQARLMSQALRKLSGAINKTKTIALFINQI B5QRW4_LACRH 166 8 -
LQARLMSKALRKIAGNMGRSGCTVIFLNQL RECA_SYNP2 169 8 -
LQARMMSQAMRKMSGVISKSNVVAIFINQI RECA_ACHLA 166 8 -
LQARLMSKALRKIAAELNKSECTIIFINQL B1C2D5_9FIRM 175 8 -
LQARMMSQAMRKLSASINKTKTIAIFINQL RECA_STRTR 179 8 -
LQARLMSQALRKITGNIGKSQCTVIFLNQL B4WLQ8_9SYNE 168 8 -
LQARLMSQALRKLAGTLNRTGTIAIFINQI B1MZY7_LEUCK 179 8 -
GQARLMSHALRKLTGTIHKSKAVVLFINQI B7DL17_DESSA 172 8 -
LQARLMSKGLRKLTGNLNKYKTTMIFINQI Q7P621_FUSNV 180 8 -
LQARLMSKALRKIAGNIGKSGCVVIFLNQL A8YJ75_MICAE 169 8 -
LQARLMSKALRKIAGNIGKSGCVVIFLNQL B0JV95_MICAN 169 8 -
LQARLLSHGLRKLTSAVSKANCILIFINQI RECA_WOLTR 172 8 -
LQARMMSQAMRKLAGHINKTKTTAIFINQL RECA1_LACLA 180 8 -
LQARLLSHALRKLTSIVSKANCLLVFINQI Q2GIE7_ANAPZ 168 8 -
LHARLMSQALRKMTGAISKSNTTCIFINQL RECA_PORG3 174 8 -
LHARLMSQALRKMTGAISKSNTTCIFINQL RECA_PORGI 174 8 -
VQARLMSKALRKLTGILHKMNCTVIFINQI RECA_SULDN 165 8 -
LQARLMSQALRKIAGSVNKSKAVVIFTNQI B7REZ5_9THEM 168 8 -
LQARLMSQALRKIAGSVNKSKAVVIFTNQI RECA_THESQ 168 8 -
LQARLMSQALRKIAGSVNKSKAVVIFTNQI RECA_THEP1 168 8 -
LQARLMSQALRKIAGSVNKSKAVVIFTNQI RECA_THEMA 168 8 -
LHARLMSQALRKMTSTISKTNCTVIFINQL Q1VQU1_9FLAO 171 8 -
LQARLMSKALRKIAGNIGKSGCVVIFLNQL B7KLB5_CYAP7 169 8 -
LQARLMSQALRKLTSLLAKTKTSIIFINQI B2KEX6_ELUMP 165 8 -
LQARLMSQAMRKLTGVISKSKTIVIFINQI A3ZNU6_9PLAN 203 8 -
LHARLMSQALRNKTANISRWNKLVIFKKQI RECA_ACIFA 167 8 -
LQARLMSQALRKIAGSVNKSKAVVIFTNQI B9K7N7_THENE 168 8 -
LQARLMSQALRKLAGNINKSKTVVIFINQT B7ID28_THEAB 169 8 -
LQARLMSQALRKLTGAISKTGCICIFINQL B3ETT2_AMOA5 167 8 -
LQARLMSKALRKIAAELNKSECTIIFINQL B0N0K4_9FIRM 178 8 -
LQARLMSQALRKLTGAISKSSSVAVFINQL B4S4R7_PROA2 177 8 -
LQARLMSQALRKLTAVLYKSNTAAIFINQI A6ZIK1_THEAQ 165 8 -
KQARLMSQALRKLKGIVHKSNTSLIFINQI A8UQJ4_9AQUI 173 8 -
LQARLMSKALRKIAGNIGKSGCTVIFLNQL B4VLI9_9CYAN 170 8 -
LQARLMSQALRKLTAVLSKSNTAAIFINQV B7A501_THEAQ 165 8 -
LQARLMSQALRKLTAVLSKSNTAAIFINQV RECA_THEAQ 165 8 -
LQARMMSQAMRKLAGHINKTKTTAIFINQL RECA_LACLC 180 8 -
LQARMMSQAMRKLAGHINKTKTTAIFINQL RECA_LACLS 180 8 -
LQARMMSQAMRKLAGHINKTKTTAIFINQL RECA_LACLM 180 8 -
LQARLMSQALRKLTGICHRTDTTLIFINQL A9G764_SORC5 169 8 -
SQARLMSHAMRKLTGTIHKSRTSVIFINQI RECA_DESDG 173 8 -
LQARLMSQALRKLAGTLNRTGTIAIFINQI RECA_OENOB 165 8 -
LQARLMSQALRKINGNISKTGCTVIFLNQL RECA_THEEB 172 8 -
LQARLMSQALRKLTGTINKTSCSCIFINQL A1ZUC7_9SPHI 169 8 -
KQARLMSQALRKLKGAVHRSNTALIFINQI RECA_AQUPY 171 8 -
LQARMMSQALRKLTSTLARSQTCAIFINQI B5LMU1_9CHLA 167 8 -
MQARLMSQGLRKLTAILNKSKTTCVFTNQL B2ERF9_9BACT 211 8 -
GHARLMSHALRKLTGTIHKSHTAVIFINQI Q1MP41_LAWIP 172 8 -
AQARMMSKAMRKLSGVMNRSECTAIFINQL A8RC56_9FIRM 172 8 -
KQARLMSQALRKLKGAVHKSNTALIFINQI O67905 168 8 -
LQARMMSQALRKLTASLSKSNTCAIFINQI Q6M9N0_PARUW 172 8 -
LQARLMSQSMRKLTGAIAKSKSAVVFINQI RECA_RHOBA 188 8 -
LQARLMSQALRKLTAVLAKSNTAAIFINQV RECA_THET2 165 8 -
LQARLMSQALRKLTAVLAKSNTAAIFINQV RECA_THET8 165 8 -
LQARLMSQALRKIAGNVNRSKAIVIFTNQI A8F8W0_THELT 170 8 -
SQARLMSQAMRRLTAIVSKTKCICLFTNQI B5JPT4_9BACT 175 8 -
LQARLMSQALRKLTAVLAKSNTAAIFINQV RECA_THETH 165 8 -
LQARMMSQAMRKLTGAISKSKTTVIFINQI A6CF28_9PLAN 182 8 -
AQARLMSAALRKLTSFISKARTVCIFTNQI B2UPW5_AKKM8 178 8 -
LQARMMSQALRKLTATLARTNTCAIFINQI RECA_CHLMU 167 8 -
LQARLMSQALRKLTAILSKTGTAAIFINQV B1NEZ0_9DEIO 178 8 -
LQARLMSQALRKLTAILSKTGTAAIFINQV RECA_DEIGD 178 8 -
LQARMMSQALRKLTATLARTNTCAIFINQI RECA_CHLT2 167 8 -
LQARMMSQALRKLTATLARTNTCAIFINQI RECA_CHLTR 167 8 -
LQARMMSQALRKLTATLARTNTCAIFINQI RECA_CHLTB 167 8 -
LQARMMSQALRKLTATLARTNTCAIFINQI RECA_CHLTA 167 8 -
LQARMMSQALRKLTATLSRSQTCAVFINQI RECA_CHLPN 167 8 -
LQARLMSQALRKLAGNINKSKAVVIFINQT RECA_THEM4 168 8 -
LQARLMSQALRKISGTVSKSRSIVMFINQT B6YNU1_9BACT 170 8 -
LQARMMSKAMRKLAGAMNQNDCTAIFINQL B7C8F6_9FIRM 170 8 -
LQARLMSQALRKLAGSINKSKSIVIFINQV RECA_PETMO 172 8 -
LHARLMSQAMRKLTGTIASTNTLTLWVNQL B5A778_9CAUD 158 8 -
LQARLMSQAMRKLSGVAAQTNTLMVFINQL A6FZ21_9DELT 189 8 -
VQARLMSAAMRKLTSVISKSNTVAIFINQV B0MMT9_9FIRM 184 8 -
LQARLMSQALRKLAGNVNKSKVVVIFINQT A7HMK5_FERNB 167 8 -
LQARLMSKALRKITSSLSLSQCTVIFLNQL B5YLR6_THAPS 228 8 -
LQARMMSQALRKLTATLARSQTCAIFINQI RECA_CHLAB 167 8 -
LQARMMSQALRKLTATLARSQTCAIFINQI RECA_CHLCV 167 8 -
LQARMMSQALRKLTATLARSQTCAIFINQI RECA_CHLFF 167 8 -
LQARLMSQAMRKLSGIVSKSKTIVIFINQL Q2RLQ9_MOOTA 165 8 -
LQARLMSQALRKLTGAASRSKTCIIFTNQI A6PMM6_9BACT 174 8 -
LQARLMSQALRKLTAIVSKSNTAVIFINQT B0VJL1_9BACT 166 8 -
LQARLMSQALRKMAGSINNTNTLVIFINQL B3WAZ9_LACCB 179 8 -
LQARLMSQALRKMAGSINNTNTLVIFINQL Q034K4_LACC3 179 8 -
LQARLMSQALRKMAGTINNTNTLVIFINQL B5QRV4_LACRH 179 8 -
LQARLMSQALRKLTAILSKTGTAAIFINQV RECA_DEIRA 178 8 -
LHARLMSKAMRVLKGAVNKSNTALILINQI B2V7T2_SULSY 170 8 -
LIARLMSQALRKLTSIINKSKCTLIFINQL RECA_TREPA 179 8 -
LIARLMSQALRKLTSIINKSKCTLIFINQL RECA_TREPS 179 8 -
AQARLMSSALRKLTAQISKAKTVCIFTNQL B3DW93_METI4 141 8 -
LQARLMSKALRKITGILSKSNTCIMFINQL RECA_BORHD 179 8 -
LQARLMSKALRKITGILSKSNTCIMFINQL RECA_BORHE 179 8 -
LHARLMSQAMRKLTGTISSTNTLTLWVNQL B5A674_9CAUD 158 8 -
LHARLMSQAMRKLTGTISSTNTLTLWVNQL Q857P7_9CAUD 158 8 -
LHARLMSQAMRKLTGTISSTNTLTLWVNQL Q1A0V6_9CAUD 158 8 -
LQARLMSKALRKITAILSKSNTCIMFINQI RECA_BORDL 179 8 -
LQARLMSQALRKLTGIASKTGTAIVFLNQL B5Y8R3_COPPD 173 8 -
VQARLMSQALRKLTPSLSRSQTLLIFINQV B8LRS8_PICSI 256 8 -
LQARLMSKALRKITGILSKSNTCIMFINQI B7XTL8_BORGA 181 8 -
LQARLMSKALRKITGILSKSNTCIMFINQI B7J164_BORBZ 181 8 -
LQARLMSKALRKITGILSKSNTCIMFINQI RECA_BORBU 181 8 -
LQARLMSKALRKITGILSKSNTCIMFINQI B9AAC3_BORBU 181 8 -
LQARLMSKALRKITGILSKSNTCIMFINQI RECA_BORAP 181 8 -
SQARLMSQAMRRLTAVVSKTKCILIFTNQI A7CVA2_9BACT 206 8 -
KQARLMSQALRKLKGATNKSNTTLIFINQI B4U5L7_HYDS0 166 8 -
SQARLMSQAMRRLTAVVSKTACVCIFTNQI B1ZWP7_OPITP 178 8 -
LQARLMSKALRKITGILSKSNTCIMFINQI B7XUE1_BORGA 170 8 -
LQARLMSQALRKMSGNASKAGCTLIFLNQI RECA_ARATH 242 8 -
LQARLMSKSLRKITGILSKSNTCIMFINQI RECA_BORGA 181 8 -
LQARLMSQALRKMSGNASKAGCTLMFLNQI B8AN40_ORYSI 247 8 -
LQARLMSQALRKMSGNASKAGCTLMFLNQI Q10G85_ORYSJ 229 8 -
LQARLMSQALRKMSGNASKAGCTLMFLNQI B9F9W5_ORYSJ 247 8 -
LQARLMSKALRRLTHSLNSSNCLLIFINQT A4PHN2_PHYPA 238 8 -
LQARLMSQALRKMSGNASKAGCTLVFLNQI B9SVD4_RICCO 152 8 -
AHARLMSQALRKINVNAAKAGTTIIFLNQL A4S409_OSTLU 169 8 -
LQARLMSQALRKMSGNASKAGCTLMFLNQI B6T788_MAIZE 225 8 -
LQARLMSSALRSLTGSINKTRTCLIFTNQL A6DUF6_9BACT 171 8 -
AHARLMSQALRKINVNAAKAGTTIIFLNQL Q00ZP1_OSTTA 196 8 -
LQARLMSKALRKITGSLSKNKTSVIFINQV RECA_MYCPU 173 8 -
AQARLMSKALRKITGSLNKSKTTVIFINQI RECA_MYCMO 161 8 -
AQARLMSKALRKITASLNKNGTTVIFINQI RECA_MYCH2 166 8 -
AQARLMSKALRKITASLNKNGTTVIFINQI RECA_MYCHJ 166 8 -
AQARLMSKALRKITASLNKNGTTVIFINQI RECA_MYCH7 166 8 -
LQARLMSQALRKMSANAARANCTIIFLNQI A4PHN3_PHYPA 259 8 -
VQARLMSKALRKITGNLHKNKTTVIFVNQI A5IYZ1_MYCAP 172 8 -
LQARMMSKALRKLNGVISKSKTTVIFINQL RECA_MESFL 169 8 -
LQARMMGKAMRIQSGIISKTNTVVIYINQL B3R0F8_APPPP 174 8 -
AQARLMSKALRKITGNLNKNQTTIIFINQI Q4A5K2_MYCS5 163 8 -
LQARMMSKALRKLNGLIAKSNTTVIFINQL RECA_MYCMS 180 8 -
LQARMMSKALRKLNGLIAKSNTTVIFINQL Q2SRU1_MYCCT 163 8 -
AQARLMSKALRKITGSLAKNKTTIIFINQI B3PM51_MYCA5 168 8 -
SQARLLSQALRKLSASASKSKTTLFFINQL A8I670_CHLRE 221 8 -
LQARMMSKALRKLNWLIAKSNTTVIFINQL RECA_MYCMY 181 8 -
THARMMSKGLKILQTSLSKHKTTVIFINQV RECA_MYCPE 163 8 -
AHARLMSKGLRKIQPLINKSKTAIIFINQL B1RUM9_UREPA 165 8 -
AHARLMSKGLRKIQPLINKSKTAIIFINQL RECA_UREPA 165 8 -
AHARLMSKGLRKIQPLINKSKTAIIFINQL RECA_UREP2 165 8 -
AHARLMSKGLRKIQPLINKSKTAIIFINQL B2D8D9_UREPA 165 8 -
AHARLMSKGLRKIQPLINKSKTAIIFINQL B1RW17_UREPA 165 8 -
IHARMMNQALRKQSHIVYKSNAILIYINQL Q9LA65_PEWBP 166 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL B1RXB9_UREUR 165 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL RECA_UREU1 165 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL B5BMD7_UREUR 165 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL B3XV19_UREUR 165 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL B3XSE0_UREUR 165 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL B2NH97_UREUR 165 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL B2NFD6_UREUR 165 8 -
AHARLMSKGLRKIQPLMNKSQTAIIFINQL B2D9Z3_UREUR 165 8 -
THARMMSRGLSRIQPLLAKHNVSVIFINQL Q8RP56_MYCGA 185 8 -
TQSRIMTQALRKIHYSVGYSQTLIVFLNQV RECAM_ARATH 223 8 -
LHARMMSKGLRRVQSLLPESDTCLLFINQL RECA_MYCPN 166 8 -

Motif 4 width=29
Element Seqn Id St Int Rpt
GGNALKFYASVRLDIRRIGAIKDRDEVVG RECA_PARL1 221 15 -
GGNALKFYASVRLDIRRTGAIKKGDEVIG B8GQV3_9GAMM 211 15 -
GGNALKFYASVRLDIRRTGAIKKGDEVTG RECA_METFK 211 15 -
GGNALKFYASVRLDIRRTGQIKDRDEVVG Q2N9K3_ERYLH 221 15 -
GGNALKFYASVRLDIRRTGQIKDRDEVIG A3WBC0_9SPHN 221 15 -
GGNALKFYASVRLDIRRTGQIKDRDEIVG Q2G8V4_NOVAD 223 15 -
GGNALKFYASVRLDIRRIGALKARDEVIG A3VUD5_9PROT 220 15 -
GGNALKFYASVRLDIRRTGQIKNGDEIVG Q1GSD4_SPHAL 224 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG A5VQX5_BRUO2 285 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG RECA_BRUSU 222 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG RECA_BRUME 222 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG RECA_BRUC2 222 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG RECA_BRUAB 222 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG RECA_BRUA2 222 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG RECA_BRUA1 222 15 -
GGNALKFYASVRLDIRRTGQIKDRDEVIG A5P749_9SPHN 210 15 -
GGNALKFYASVRLDIRRTGAIKKGDEIIG Q3SGU3_THIDA 231 15 -
GGNALKFYASVRLDIRRTGAIKKGDEVIG RECA_CHRVI 211 15 -
GGNALKFYASVRLDIRRIGSIKERDEVVG RECA_OCHA4 222 15 -
GGNALKFYASVRLDIRRIGAIKKGDEVIG RECA_DECAR 211 15 -
GGNALKFYASVRLDIRRIGSIKERDEVMG RECA_BRUSI 222 15 -
GGNALKFYASVRLDIRRIGAIKDRDEIVG B6R0D5_9RHOB 221 15 -
GGNALKFYSSVRLDIRRTGAIKKGDEVIG RECA_METCL 211 15 -
GGRALKFYSTVRLDVRRIESIKMGNDVVG B3KIK6_9BACI 185 15 -
GGNALKFYASVRLDIRRTGAIKKGDEVTG RECA_METFL 211 15 -
GGNALKFYASVRLDIRRIGTIKKGDEAIG B7YNW3_VARPD 223 15 -
GGNALKFYASVRLDIRRTGQIKDRDDIVG Q1NDI6_9SPHN 250 15 -
GGRALKFYASVRLDVRRLESIKQGNEVIG A3DEA3_CLOTH 209 15 -
GGRALKFYASVRLDVRRLESIKQGNEVIG B4BH94_CLOTM 209 15 -
GGNALKFYASVRLDIRRIGAVKEREEVIG B0JBR8_RHILT 222 15 -
GGNALKFYASVRLDIRRIGAVKEREEVIG RECA_RHILW 222 15 -
GGNALKFYASVRLDIRRIGAVKEREEVIG RECA_RHIL3 222 15 -
GGNALKFYASVRLDIRRIGAIKKSDEVVG B7J7A9_ACIF2 211 15 -
GGNALKFYASVRLDIRRIGAIKKSDEVVG RECA_ACIF5 211 15 -
GGNALKFYASVRLDIRRIGSVKEREEVIG RECA_RHIE6 222 15 -
GGNALKFYASVRLDIRRIGAIKDRDEVVG A8TPM0_9PROT 221 15 -
GGNALKFYASVRLDIRRTGAIKDRDEVVG A5V3L4_SPHWW 224 15 -
GGNALKFYSSVRLDIRRIGQIKDREEVIG Q0BYM2_HYPNA 214 15 -
GGNALKFYASVRLDIRRIGAIKERDEVVG RECA_BRAJA 222 15 -
GGNALKFYASVRLDIRRTGSIKSGDEVIG RECA_HERSE 218 15 -
GGNALKFYASVRLDIRRIGAVKEREEVVG B9JFS7_9RHIZ 222 15 -
GGNALKFYASVRLDIRRIGAIKDRDEVVG A0NP88_9RHOB 208 15 -
GGNALKFYSSVRLDIRRIGAIKNRDEVIG A3UDY2_9RHOB 221 15 -
GGNALKFYASVRLDIRRIGSIKDREDITG B2IHX1_BEII9 209 15 -
GGRALKFYSSVRLDVRRIEAIKQSNEVVG B8I7D2_CLOCE 209 15 -
GGNALKFYASVRLDIRRIGSIKKNDEVIG B2SYF4_BURPP 221 15 -
GGNALKFYASVRLDIRRIGSVKEREEVVG RECA_RHIME 209 15 -
GGRALKFYSSVRLEVRRAETLKQGNDMVG RECA_BACHD 209 15 -
GGNALKFYASVRLDIRRIGAIKDGDEVVG RECA_PSEA6 210 15 -
GGRALKFYASVRLDVRRIDVIKQGNDIIG A6TRJ2_ALKMQ 208 15 -
GGNALKFYASVRLDIRRIGAIKERDEVIG A4YXR0_BRASO 222 15 -
GGNALKFYASVRLDIRRIGSVKDREETVG RECA_MESSB 222 15 -
GGNALKFYASVRLDIRRIGSIKKGDEVVG RECA_RALME 220 15 -
GGNALKFYASVRLDIRRIGAIKERDEVVG A3WVK2_9BRAD 222 15 -
GGNALKFYASVRLDIRRIGAIKERDEVVG RECA_NITWN 222 15 -
GGRALKFYASVRLEVRRAEQIKQGNDMVG A4IMG9_GEOTN 185 15 -
GGRALKFYASVRLEVRRAEQIKQGNDMVG B4BIW4_9BACI 210 15 -
GGNALKFYASVRLDIRRIGQIKERDEVVG Q13AC3_RHOPS 223 15 -
GGRALKFYASVRLEVRRAEQIKQGNDMVG B7GJN3_ANOFW 255 15 -
GGNALKFYASVRLDIRRIGSVKDRDEVVG RECA_RHILO 222 15 -
GGNALKFYASVRLDIRRIGAVKDKEEVVG RECA_RHORT 222 15 -
GGNALKFYASVRLDIRRIGAVKEREEVIG RECA_RHILV 209 15 -
GGNALKFYSSVRLDIRRIGAVKEGDEVVG RECA_ALTMD 210 15 -
GGNALKFYASVRLDIRRIGSVKEREEVVG RECA_SINMW 222 15 -
GGNALKFYSSVRLDIRRIGAIKKGDEVLG B5JVA0_9GAMM 210 15 -
GGNALKFYSSVRLDIRRIGAIKKGDEILG RECA_THICR 211 15 -
GGNALKFYASVRLDIRRVSTLKDRDEPIG B8IP29_METNO 224 15 -
GGNALKFYASVRLDIRRVSTLKDRDEPIG RECA_METS4 224 15 -
GGNALKFYASVRLDIRRIGAIKNGEEIIG A1T002_PSYIN 213 15 -
GGNALKFYSSVRLDIRRIGAIKKGDEVVG B6BWK4_9PROT 211 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG B7QSS1_9RHOB 222 15 -
GGNALKFYASVRLDIRRIGSVKEREEVVG RECA_RHIEC 222 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG A2UZ65_SHEPU 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_SHESW 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_SHEPC 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_SHEB9 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_SHEB8 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_SHEB5 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG B8E8U2_9GAMM 212 15 -
GGNALKFYASVRLDIRRIGSVKEREEVIG RECA_RHILP 222 15 -
GGNALKFYASVRLDIRRIGAIKERDEVVG RECA_NITHX 222 15 -
GGRALKFYSSVRLEVRRAETLKQGNEMVG Q2B1K9_9BACI 200 15 -
GGNALKFYASVRLDIRRIGQIKERDEVVG B3QI72_RHOPT 223 15 -
GGNALKFYASVRLDIRRIGQIKERDEVVG RECA_RHOPA 209 15 -
GGNALKFYASVRLDIRRTGAIKNRDEVVG B4WEL0_9CAUL 222 15 -
GGRALKFYASVRLDVRKVDSIKQGNDVVG A8MFC2_ALKOO 208 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG Q2T0V0_BURTA 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A4JHK1_BURVG 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG RECA_BURS3 211 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG RECA_BURCJ 211 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG RECA_BURCE 211 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG Q0BC68_BURCM 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B1YVY9_BURA4 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B1T7P6_9BURK 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B1FQP9_9BURK 220 15 -
GGNALKFYASVRLDIRRIGAVKEREEVVG RECA_AGRTU 222 15 -
GGRALKFYASVRLEVRKAEAIKQGSEVIG A1HUE5_9FIRM 209 15 -
GGNALKFYASVRLDIRRIGSIKDRDTVVG RECA_AZOLI 222 15 -
GGNALKFYASVRLDIRRIGSIKDHEEVIG B8ETR1_METSI 222 15 -
GGNALKFYASVRLDIRRIGSIKKNDEVIG Q13UH6_BURXL 221 15 -
GGNALKFYASVRLDIRRIGSIKKNDEVIG Q842H8_9BURK 221 15 -
GGNALKFYASVRLDIRRIGSIKKNDEVIG B1G226_9BURK 221 15 -
GGNALKFYSSVRLDIRRIGSIKDRDEVVG A6FSR2_9RHOB 223 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A1V6W5_BURMS 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG RECA_BURPS 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG RECA_BURMA 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG RECA_BURM1 211 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG Q3JVL9_BURP1 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B9CCE0_9BURK 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B9BTL7_9BURK 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B9B3Z8_9BURK 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B7CIU0_BURPS 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B2H414_BURPS 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B1HFF1_BURPS 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A9K5W0_BURMA 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A8KKV8_BURPS 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A8E9V2_BURPS 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A5XX15_BURMA 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A5TR11_BURMA 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A5JC36_BURMA 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A3NRX4_BURP0 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A3N690_BURP6 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A3MH63_BURM7 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A2W7P8_9BURK 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A2S8U6_BURM9 220 15 -
GGNALKFYASVRLDIRRIGSIKKGDDVIG RECA_RALEJ 220 15 -
GGNALKFYASVRLDIRRIGSIKKNDEVIG B5WK23_9BURK 221 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A0KA75_BURCH 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG Q1BTW3_BURCA 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG B1JY17_BURCC 220 15 -
GGNALKFYSSVRLDIRRIGSIKKNDEVIG A2VVQ7_9BURK 220 15 -
GGNALKFYASVRLDIRRIGAIKDRDEVTG Q1YEB7_MOBAS 222 15 -
GGNALKFYSSVRMDIRRLGAIKKGDEVLG RECA_ALHEH 212 15 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG A3SNY5_9RHOB 215 15 -
GGNALKFYASVRLDIRKIATLKQGDQVIG B3E9Z2_GEOLS 210 15 -
GGNALKFYASVRLDIRRTGAIKDRDEVIG RECA_RHOCA 223 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG A4VJP2_PSEU5 185 15 -
GGNALKFYASVRLDIRRIGSIKDRDEVTG Q0FZI3_9RHIZ 222 15 -
GGNALKFYASVRLDIRRIGQIKERDEVVG Q07R91_RHOP5 222 15 -
GGNALKFYASVRLDIRRTGTIKKGDEAIG A1WCY0_ACISJ 222 15 -
GGNALKFYASVRLDIRRTGTIKKGDEAIG B9MHR9_9BURK 222 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG A3VJG5_9RHOB 226 15 -
GGRALKFYSSVRLEVRRAEAIKQGNDIVG B1HR36_LYSSC 185 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDIVG Q8GJ70_BACME 209 15 -
GGNALKFYASVRLDIRRTGAIKERDEVIG B6JBM2_OLICO 222 15 -
GGNALKFYASVRLDIRRIGSIKKGDDVIG RECA_RALEH 220 15 -
GGRALKFYSSVRLEVRRAEALKQGNEIVG RECA_BACSK 209 15 -
GGNALKFYSSVRLDIRRIGSIKDRDEVVG B6BE26_9RHOB 221 15 -
GGNALKFYASVRLDIRRIGSIKKGDEVVG RECA_RALEU 220 15 -
GGNALKFYASVRLDIRRIGAIKDRDEVVG A3V9G1_9RHOB 223 15 -
GGKALKFYASVRLDVRRIETLKDGTDPVG A3TMD7_9MICO 218 15 -
GGNALKFYSSVRLDIRRTGTIKDGDEVVG A4BCJ0_9GAMM 215 15 -
GGNALKFYASVRLDIRRIGSIKRGDEVVG A3RQ47_RALSO 219 15 -
GGNALKFYASVRLDIRRIGSIKRGDEVVG B5SGP7_RALSO 219 15 -
GGNALKFYASVRLDIRRIGSIKRGDEVVG B5S8Q7_RALSO 219 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG B1BG38_CLOPE 213 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG RECA_CLOPE 213 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG RECA_CLOP1 213 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG B1RQ41_CLOPE 213 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG B1RIJ5_CLOPE 213 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG B1RAI9_CLOPE 213 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG B1BWW2_CLOPE 213 15 -
GGNALKFYASVRLDIRRTGTIKKGDEAIG A1WET8_VEREI 224 15 -
GGNALKFYASMRLDIRRIGSIKKGDEVVG B1XRZ6_POLNS 227 15 -
GGRALKFYSSVRLEVRRAEQLKLGNDIVG Q8GJ73_BACME 209 15 -
GGNALKFYASVRLDIRRISTLKDRDEAIG RECA_METRJ 224 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_SHEON 212 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_SHESR 212 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_SHESM 212 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_SHESA 212 15 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG B6AYP7_9RHOB 215 15 -
GGNALKFYASVRLDIRRIGAIKKSDEVVG RECA_THIFE 211 15 -
GGNALKFYSSVRLDIRRIGSIKKGEEVVG RECA_BORPD 219 15 -
GGNALKFYASVRLDIRRIGQIKERDEVVG Q218Q7_RHOPB 223 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_SHEDO 212 15 -
GGRALKFYASVRLDIRRIDSIKQGDSIIG RECA_CLOB8 213 15 -
GGRALKFYASVRLEVRRADTLKQGQDMIG B8G068_DESHD 212 15 -
GGRALKFYASVRLEVRRADTLKQGQDMIG Q24W60_DESHY 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_SHEFN 212 15 -
GGNALKFYASVRLDIRRVSTLKDRDEAIG A9W5Y7_METEP 227 15 -
GGNALKFYASVRLDIRRVSTLKDRDEAIG B7KPS7_METC4 227 15 -
GGNALKFYASVRLDIRRVSTLKDRDEAIG B1ZC93_METPB 227 15 -
GGNALKFYASVRLDIRRIGAIKEGDEVVG RECA_SERMA 212 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG Q3R742_XYLFA 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XYLFM 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG Q3RE83_XYLFA 212 17 -
GGNALKFYASVRLDIRRIGMIKERDEVVG A7IMQ9_XANP2 222 15 -
GGNALKFYASVRLDIRRIGSIKKGEEVIG Q122H4_POLSJ 229 15 -
GGRALKFYSSVRLDVRKIETIKQGDEFLG RECA_CLONN 210 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG Q2C9X3_9RHOB 224 15 -
GGNALKFYASIRLDIRRIGAIKERDEVIG A5EMM4_BRASB 222 15 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG A9E4G3_9RHOB 223 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG B7V8D1_PSEA8 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEAE 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEAB 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEA7 210 15 -
GGNALKFYASVRLDIRRIGSIKKGDEVIG A1VUC3_POLNA 221 15 -
GGNALKFYSSVRLDIRRIGAIKNRDEVIG Q0AQY8_MARMM 222 15 -
GGRALKFYASVRMDIRRIDSIKQGDGITG RECA_CLOPS 213 15 -
GGNALKFYASVRLDIRRTGSVKARDEIVG B8H3I7_CAUCR 222 15 -
GGNALKFYASVRLDIRRTGSVKARDEIVG RECA_CAUCR 222 15 -
GGNALKFYASIRMDIRRIGSIKDREEVTG RECA_ACICJ 209 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDVMG RECA_BACLD 209 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDVMG RECA_BACLI 209 15 -
GGRALKFYSSVRLEVRRIETIKQGNDMVG B1DLF1_9BACL 209 15 -
GGNALKFYASMRLDIRRIGSIKKGDEVVG A4SZY2_POLSQ 227 15 -
GGNALKFYASVRLDIRRIGSIKKGEEILG RECA_LEGPN 211 15 -
GGNALKFYASVRLDIRRIGSIKKGEEILG RECA_LEGPL 211 15 -
GGNALKFYASVRLDIRRIGSIKKGEEILG RECA_LEGPH 211 15 -
GGNALKFYASVRLDIRRIGSIKKGEEILG RECA_LEGPC 211 15 -
GGNALKFYASVRLDIRRIGSIKKGEEILG RECA_LEGPA 211 15 -
GGNALKFYASVRLDIRRIGSIKKGEEILG B2C321_LEGPN 211 15 -
GGNALKFYASVRLDIRRIGSIKKGEEVIG B1XY03_LEPCP 219 15 -
GGNALKFYASVRLDIRRTGAIKDGEEIVG B9DEP2_9GAMM 210 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG B9NRH1_9RHOB 220 15 -
GGNALKFYSSIRLDIRRIGSIKDKDEVVG RECA_GLUOX 208 15 -
GGNALKFYASVRLDIRRTGTIKKGDEAIG B7X245_COMTE 220 15 -
GGRALKFYSTIRLEVRRAEQLKQGNEIVG RECA_BACCN 209 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XYLFA 212 17 -
GGNALKFYASVRLDIRRIGMIKERDEVVG A8ICX1_AZOC5 222 15 -
GGNALKFYASVRIDIRRTGSVKEGDEVVG A4C6Y7_9GAMM 210 15 -
GGRALKFYASVRLDVRRIDSIKQGDGIVG RECA_CLOBA 213 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_STRMK 212 17 -
GGNALKFYASVRLDIRRIGSIKKGDDVIG RECA_CUPTR 220 15 -
GGNALKFYASVRLDIRRIGSVKNGDEVIG RECA_PROMI 212 15 -
GGNALKFYASVRLDIRRIGSVKNGDEVIG RECA_PROMH 212 15 -
GGNALKFYASVRIDIRRIGSVKEGDEVVG Q3IFN0_PSEHT 210 15 -
GGNALKFYASVRLDIRRIGAVKDREEIVG B9JX56_AGRVI 222 15 -
GGNALKFYASVRLDIRRSGAIKNGDEVIG RECA_METCA 211 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG B8L292_9GAMM 233 17 -
GGNALKFYSSVRLDIRRIGSIKKGDEVVG Q2KYE8_BORA1 218 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSE14 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEU2 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSESM 210 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG B5HF96_STRPR 211 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG RECA_ERWCT 212 15 -
GGNALKFYSSVRLDIRRIGAVKDRDEIVG A3VX42_9RHOB 223 15 -
GGNALKFYASVRLDIRRTGTIKKGDEAIG A1TW37_ACIAC 220 15 -
GGNALKFYASVRLDIRRIGSVKERDEVTG A9D6F1_9RHIZ 222 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDIMG RECA_BACP2 209 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDIMG B4ADR5_BACPU 209 15 -
GGNALKFYSSVRLDIRRIGSIKDRDEVVG A3JSX3_9RHOB 222 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG A9EMD9_9RHOB 222 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG A9FNG9_9RHOB 222 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDVMG Q659J5_BACAM 209 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDVMG RECA_BACSU 208 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDVMG RECA_BACA2 209 15 -
GGRALKFYSSVRLEVRRAEQLKQGNDVMG Q8GJG2_BACAM 209 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG A6XC70_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALTY 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALTI 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALSV 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALPK 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALPB 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALPA 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALNS 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALHS 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALG2 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALEP 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALDC 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALCH 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_SALA4 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5Q846_SALVI 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5PUL0_SALHA 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5PGV9_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5PA02_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5NNK4_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5NBF9_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5N4V4_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5MKA1_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5CBG8_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B5BYR3_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B4A2F6_SALNE 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG B3YID4_SALET 212 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG A9MFY8_SALAR 217 15 -
GGNALKFYASVRLDIRRIGSIKRGEEVIG RECA_METPP 218 15 -
GGNALKFYASVRLDIRRTGTIKKGDVAIG Q21RF6_RHOFD 245 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANC5 212 17 -
GGNALKFYASVRMDIRKIASLKQGNDVIG A5GDB6_GEOUR 210 15 -
GGNALKFYASVRLDIRRTGAIKDRDNVIG B9KKJ7_RHOSH 233 15 -
GGNALKFYASVRLDIRRTGAIKDRDNVIG RECA_RHOSH 209 15 -
GGNALKFYASVRLDIRRTGAIKDRDNVIG RECA_RHOS1 223 15 -
GGNALKFYASVRLDIRKIASLKQGQDVIG RECA_GEOSL 211 15 -
GGNALKFYASVRLDIRRIGSIKDRDMIVG RECA_BARHE 209 15 -
GGNALKFYASVRLDIRRTGAIKDREEVIG RECA_SHELP 212 15 -
GGNALKFYASVRMEIRRVGAIKDRDEVVG RECA_MAGMM 222 15 -
GGNALKFYASVRLDIRRIGAIKDKDEVVG B9R0H5_9RHOB 221 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_KLEP7 212 15 -
GGRALKFYASVRLDVRRIDSIKQGDGIVG RECA_CLOBB 213 15 -
GGNALKFYASVRLDIRRVGQIKDRDEIVG RECA_ZYMMO 208 15 -
GGNALKFYASVRLDIRRTGAVKESDEVIG Q4IXX9_AZOVI 210 15 -
GGNALKFYASVRLDIRRIGAVKEGDNVVG RECA_KLEP3 212 15 -
GGNALKFYASVRLDIRRIGAVKNGDEIVG RECA_COLP3 210 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XYLF2 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XYLFT 212 17 -
GGNALKFYSSVRLDIRRIGAIKKGDEVVG RECA_BORBR 219 15 -
GGNALKFYSSVRLDIRRIGAIKKGDEVVG RECA_BORPE 219 15 -
GGNALKFYSSVRLDIRRIGAIKKGDEVVG RECA_BORPA 219 15 -
GGNALKFYASVRLDIRKVDAIKEGNETVG B9KXK1_THERO 209 15 -
GGNALKFYSSVRLDIRRIGAIKKGDEIIG A4BU37_9GAMM 213 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG RECA_STRAW 211 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG RECA_STRVL 211 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG RECA_STRLI 211 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG O50487 211 15 -
GGNALKFYASVRLDIRRSGVVKDGDEVVG A3N1E7_ACTP2 227 15 -
GGNALKFYASVRLDIRRSGVVKDGDEVVG B3GY31_ACTP7 227 15 -
GGNALKFYASVRLDIRRSGVVKDGDEVVG B0BQ84_ACTPJ 227 15 -
GGNALKFYASVRLDIRRIGSVKNGDEVVG RECA_ERWCA 212 15 -
GGNALKFYSSVRLDIRRIGAIKERDEVVG A3TWS8_9RHOB 223 15 -
GGNALKFYASVRMDIRKIAALKQGNDMIG B3JUW6_9DELT 213 15 -
GGNALKFYASVRMDIRKIAALKQGNDMIG RECA_GEOBB 213 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG A4ERJ5_9RHOB 221 15 -
GGNALKFYASVRLDIRKIATLKQGDAVIG RECA_GEOMG 211 15 -
GGNALKFYASVRLDIRRIGAIKEGDEVVG RECA_ERWT9 212 15 -
GGNALKFYASVRLDIRRIGSIKKNDEVIG B2JDB5_BURP8 221 15 -
GGNALKFYASVRLDIRRTGSVKQRDEIVG B4RHD9_PHEZH 222 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEP1 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEPU 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEPK 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEPG 210 15 -
GGNALKFYASQRLDIRRIGAIKNGDNVVG Q1DCH8_MYXXD 214 15 -
GGNALKFYASQRLDIRRIGAIKNGDNVVG REC2_MYXXA 214 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG A6BYJ2_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPY 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPS 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPP 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPN 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPG 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPB 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERPA 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG RECA_YERP3 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG B0HV90_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG B0HJM0_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG B0H198_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG B0GVR3_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG B0GB33_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG A9ZXU8_YERPE 212 15 -
GGNALKFYASVRLDIRRIGAVKDGDVVVG A9Z5H3_YERPE 212 15 -
GGNALKFYASVRLDIRRTGSVKNGDEVVG RECA_XENBV 212 15 -
GGNALKFYASVRIDIRRIGSVKEGDEVVG A0XYZ7_9GAMM 210 15 -
GGNALKFYASVRLDIRRCGVVKDGDEIIG B0QV50_HAEPR 227 15 -
GGNALKFYASVRLDIRRIGAVKEGDEVVG RECA_SERP5 212 15 -
GGRALKFYSSVRLEVRRAETLKLGNDAVG RECA_OCEIH 209 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_CITK8 212 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG RECA_SILPO 215 15 -
GGKALKFYASVRLDVRRIETLKDGGEAVG RECA_AMYMD 212 15 -
GGNALKFYASVRLDIRRIGSVKNGEEVVG RECA_PHOLL 212 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_STRM5 212 17 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG A3SGP7_9RHOB 223 15 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG A3T116_9RHOB 215 15 -
GGNALKFYASVRLDIRRIGAIKERDEVVG RECA_RHOVI 209 15 -
GGNALKFYASVRLDIRRIGAVKDGDNVIG RECA_ENT38 212 15 -
GGNALKFYASVRLDIRRTGGIKDRDNVIG RECA_RHOS5 223 15 -
GGNALKFYASVRLDIRRIGAVKEGDVVVG B6A8B5_9ENTR 212 15 -
GGNALKFYASVRLDIRRCGVVKDGDEIIG B8F639_HAEPR 227 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG Q308R5_STRAA 211 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG RECA_STRAM 211 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG A1AEN9_ECOK1 217 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_SHISS 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_SHISO 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_SHIFL 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_SHIF8 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_SHIDS 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_SHIBS 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_SHIB3 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOUT 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOSE 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOLI 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOLC 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOL6 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOL5 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECOHS 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECO5E 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG RECA_ECO24 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B7UHB7_ECO27 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B7NSH9_ECO7I 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B7N6S9_ECOLU 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B7MKG8_ECO45 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B7M9D6_ECO8A 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B7LW30_ESCF3 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B7LEB1_ECO55 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B6ZWC2_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3XHH4_ECOLX 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3X0Z2_SHIDY 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3WLX1_ECOLX 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3ILR5_ECOLX 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3I8V5_ECOLX 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3HQ29_ECOLX 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3HDP6_ECOLX 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3BYJ2_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3BJ81_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3B4W2_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3ANH0_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B3A6T9_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B2PF74_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B2P7H8_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B2NRK8_ECO57 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B2N1H9_ECOLX 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B1LQ17_ECOSM 212 15 -
GGNALKFYASVRLDIRRIGAVKEGENVVG B1EGX3_9ESCH 212 15 -
GGNALKFYASVRLDIRRTGAIKDREEVIG RECA_SHEHH 212 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEFL 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSETO 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEE4 210 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEPW 210 15 -
GGNALKFYSSVRLDIRRIGSVKDRDEIVG B5JZH2_9RHOB 222 15 -
GGNALKFYASVRLDIRRAGSIKDRDEVTG A1AZL5_PARDP 223 15 -
GGRALKFYSSVRLEVRRAEAIKQGNDIVG A3ICA9_9BACI 209 15 -
GGRALKFYASVRLDIRRIETLKDGTDAVG B1VXV8_STRGG 211 15 -
GGNALKFYSSVRLDIRRIGSIKDRDEVVG Q1GHA3_SILST 222 15 -
GGRALKFYSSVRLDVRRIDTIKQGDEFLG RECA_CLOTE 210 15 -
GGNALKFYASVRMDIRRIGSIKDKDEVTG RECA_ACEPO 214 15 -
GGNALKFYASVRLDIRRTGAIKDRDEVIG B8CJQ6_9GAMM 212 15 -
GGNALKFYASVRFDIRRIGQLKDKEEVIG Q0BSC0_GRABC 215 15 -
GGNALKFYASVRLDIRRTGAIKDREEVIG RECA_SHEPA 212 15 -
GGNALKFYSSVRLDIRRTGALKEGDEVVG RECA_IDILO 210 15 -
GGNALKFYASVRLDIRRTGSVKNGDEVVG RECA_XENNE 212 15 -
GGRALKFYASVRLEVRRVEAIKQGNDVVG B7DS99_9BACL 209 15 -
GGNALKFYSSVRMDIRKIATLKQGQDVIG Q3A1W3_PELCD 212 15 -
GGNALKFYASVRLDIRRIGSIKKGDEVVG RECA_RALSO 219 15 -
GGNALKFYASVRLDIRRIGAVKDGDEVTG A3JHQ1_9ALTE 210 15 -
GGNALKFYASVRLDIRRTGSIKKGEEVIG RECA_NITMU 211 15 -
GGNALKFYSSVRLDIRRIGAIKKGEEILG A9KG26_COXBN 210 15 -
GGNALKFYSSVRLDIRRIGAIKKGEEILG RECA_COXBU 210 15 -
GGNALKFYSSVRLDIRRIGAIKKGEEILG B6J042_COXB2 210 15 -
GGNALKFYSSVRLDIRRIGAIKKGEEILG A9ZH63_COXBU 210 15 -
GGNALKFYSSVRLDIRRIGAIKKGEEILG A9NCN5_COXBR 210 15 -
GGNALKFYASVRMDIRRTGTIKRGDEVVG RECA_AZOSB 211 15 -
GGNALKFYSSVRLDIRRTGAIKQGDEVVG Q2BQV7_9GAMM 210 15 -
GGNALKFYASVRLDIRRIGSIKRGDDVVG A7CFE0_BURPI 308 15 -
GGNALKFYASVRLDIRRIGSIKRGDDVVG B2UGD9_RALPJ 219 15 -
GGNALKFYASVRLDIRRIGQIKERDEVVG Q2ITM5_RHOP2 224 15 -
GGNALKFYASQRLDIRRIGAIKNGENVVG Q08Y00_STIAU 214 15 -
GGNALKFYASVRLDIRRIGAIKEGTESVG B8FL00_9DELT 212 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A1EPV0_VIBCH 268 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG RECA_VIBCH 210 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG RECA_VIBC3 210 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A6XXS5_VIBCH 268 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A6AEW1_VIBCH 268 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A6A6C3_VIBCH 268 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A3GQD3_VIBCH 210 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A3ENA6_VIBCH 268 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A3EGF8_VIBCH 268 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A2PUQ2_VIBCH 210 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A2PKZ0_VIBCH 210 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A2P8I1_VIBCH 210 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVVG A1F832_VIBCH 210 15 -
GGNALKFYASVRLDIRRIGSVKDGDEIIG Q45ND1_MORCA 211 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG A3K228_9RHOB 215 15 -
GGNALKFYASVRMDIRKIASLKQGNDVIG B9M365_9DELT 210 15 -
GGNALKFYASVRLDIRRIGAVKEGDVVVG RECA_YERE8 212 15 -
GGNALKFYASVRLDIRRTGSIKNRDEIVG RECA_CAUSK 222 15 -
GGNALKFYASVRMDIRRIGSIKEGDEVLG RECA_DICNV 211 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEIVG Q0FAQ7_9RHOB 222 15 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG B7RH74_9RHOB 223 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEST 210 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG A9M0G4_NEIM0 186 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG RECA_NEIMF 211 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG RECA_NEIGO 211 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG RECA_NEIG2 211 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG RECA_NEIG1 211 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG Q1KMW2_NEIME 211 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANOM 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANOR 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANOP 212 17 -
GGNALKFYASVRLDIRRTGAIKERDEVVG RECA_SHEWM 212 15 -
GGNALKFYASVRLDIRRIGAVKEGEEVVG RECA_ENTS8 212 15 -
GGNALKFYASVRLDIRRTGSIKSGDEVIG RECA_HERAR 218 15 -
GGNALKFYSSVRLDIRRTGALKEGDEVVG A3WM74_9GAMM 210 15 -
GGKALKFYASVRLDVRRIETLKDGTEAVG RECA_FRAAA 212 15 -
GGNALKFYASVRLDIRRTGSIKSGDEVIG RECA_JANMA 218 15 -
GGRALKFYASIRLEVRKQENIKQGTDIIG A5D2R8_PELTS 210 15 -
GGNALKFYASVRLDVRRIGAIKKGDEVMG Q0F3T6_9PROT 209 15 -
GGNALKFYSSVRLDIRRIGVIKKGEEILG B6J6Y7_COXB1 210 15 -
GGNALKFYSSVRLDIRRIGSVKEGDEVVG RECA_SACD2 210 15 -
GGNALKFYASVRLDIRRIGAVKDGENVVG B6FH76_9ENTR 217 15 -
GGRALKFYASVRLDVRRVEALKNGTELIG B0P6Q8_9FIRM 228 15 -
GGNALKFYASVRLDIRRSGVVKDGDEVVG RECA_HAEDU 226 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANC8 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANCP 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANCB 212 17 -
GGRALKFYASVRMDIRKIDTIKQGEEMIG RECA_CLOAB 210 15 -
GGNALKFYASVRLDIRRVGQIKDRDEIVG Q8GF01_ZYMMO 223 15 -
GGNALKFYASVRLDIRRTGAIKKGDEVVG RECA_AZOSE 211 15 -
GGNALKFYSSVRMDIRRLGAIKKGDEVLG RECA_HALHL 212 15 -
GGNALKFYSSVRLDIRRTGAVKNGDEVVG Q1MYV6_9GAMM 210 15 -
GGNALKFYSSVRLDIRRIGAVKDGDEIVG Q1YR87_9GAMM 210 15 -
GGNALKFYASVRLDIRRTGAIKDRDEVIG RECA_SHESH 212 15 -
GGNALKFYASVRLDIRRAGSIKDRDEVTG RECA_PARDE 223 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEF5 210 15 -
GGNALKFYASVRLDIRRTGAVKDGDEIVG A0YD74_9GAMM 212 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ16_MYCSM 213 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG RECA_MYCSM 213 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG Q1KMW1_NEIME 211 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG RECA_NEIMB 211 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG RECA_NEIMA 211 15 -
GGNALKFYSSVRLDIRRTGSIKKGEEVLG Q1KMW8_NEIME 211 15 -
GGKALKFYASVRLDVRRIETLKDGTNPVG RECA_KINRD 212 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_SHEAM 212 15 -
GGNALKFYSSVRLDIRRIGSIKDRDEVVG A6E088_9RHOB 223 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ28_9MYCO 213 15 -
GGNALKFYASVRLDIRRIGAVKNGEEIVG B2PTZ5_PROST 223 15 -
GGNALKFYSSVRLDIRRIGSIKKGEEVIG A6GU74_9BURK 219 15 -
GGNALKFYASVRLDIRRTGGIKKGDEVIG RECA_CHRVO 212 15 -
GGNALKFYASVRMDIRRIGQIKDKDEVVG A9HM16_GLUDA 245 15 -
GGNALKFYASVRMDIRRIGQIKDKDEVVG B5ZD74_GLUDA 214 15 -
GGNALKFYASVRLDIRRIGSVKEGDVVVG Q6YI31_9ENTR 212 15 -
GGNALKFYASVRLDIRRVGALKKGDEIVG B6BZW2_9GAMM 211 15 -
GGNALKFYASVRLDIRRVGALKKGDEIVG Q3JCL0_NITOC 211 15 -
GGNALKFYSSVRLDIRRIGAVKDGDEVVG A6EV17_9ALTE 210 15 -
GGRALKFYASIRMDVRKIDVIKQGNDIIG Q3ACX3_CARHZ 210 15 -
GGKALKFYASVRLDVRRIETLKDGTDMVG RECA_NOCSJ 211 15 -
GGNALKFYASVRMDIRKIATLKQGDAVIG A1ATV2_PELPD 216 15 -
GGNALKFYASVRLDIRRTGTIKKGDEAIG RECA_DELAS 218 15 -
GGNALKFYASVRLDIRRVGSIKNGDEVIG RECA_HAES1 212 15 -
GGNALKFYASVRLDIRRVGSIKNGDEVIG RECA_HAES2 212 15 -
GGNALKFYASVRLDIRRIGAVKNGEEIVG B6XAT0_9ENTR 212 15 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG Q165U4_ROSDO 223 15 -
GGNALKFYASVRLDIRRIGSIKDKELVVG RECA_BARBK 209 15 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANAC 212 17 -
GGNALKFYASVRLDIRRIGAIKKGDEIIG RECA_XANCI 212 17 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG A3XXM0_9VIBR 210 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG B7VK57_VIBSL 214 15 -
GGKALKFYSSVRLDVRRIETLKDGTEAVG Q5QJ25_9MYCO 212 15 -
GANALKFYASVRLDIRRTGAVKESDEVIG RECA_AZOVI 210 15 -
GGNALKFYASVRLDIRRIGSIKDRDMIVG RECA_BART1 209 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG RECA_PSEPF 210 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG RECA_RHOSR 213 15 -
GGKALKFYASVRLDVRRIETLKDGTEAVG RECA_FRASC 211 15 -
GGNALKFYSSVRMDIRKIATLKQGQDVIG Q1K3C4_DESAC 212 15 -
GGNALKFYSSVRLDIRRTGAVKEGEEVVG A4XWQ4_PSEMY 210 15 -
GGNALKFYSSVRLDIRRIGAVKQGDEVTG B4X4W3_9GAMM 209 15 -
GGNALKFYSSVRLDIRRIGAVKQGDEVTG Q0VNJ9_ALCBS 209 15 -
GGNALKFYSSVRLDIRRIGSVKDRDEIVG A8LLK7_DINSH 223 15 -
GGNALKFYASVRLDIRRIGSVKEGDVVVG RECA_SODGL 212 15 -
GGNALKFYASVRLDIRRIGSVKEGDVVVG RECA_SODGM 212 15 -
GGKALKFYASVRLDIRRIETLKDGTDAVG RECA_LEIXX 212 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG B7HDQ4_BACC4 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG RECA_BACWK 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG RECA_BACCR 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG RECA_BACC1 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG RECA_BACAN 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG RECA_BACAH 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG Q4MMJ9_BACCE 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGNDIVG B7ITN1_BACC2 209 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q2M4U4_9MYCO 213 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ31_9MYCO 213 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ30_MYCFO 213 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ19_9MYCO 213 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG B9EBH1_9STAP 209 15 -
GGNALKFYASVRLDIRRTGAIKDGEEVVG RECA_PROVU 212 15 -
GGNALKFYASVRLDIRRIGAVKNGDEIVG Q1ZCX1_9GAMM 213 15 -
GGRALKFYSSIRMDVRRIETLKQGGEMVG B7Y4S4_RUMHA 215 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG Q2M4U7_9MYCO 212 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG RECA_MYCA9 212 15 -
GGNALKFYASVRLDIRRIGAIKEGDVVVG RECA_ENTAG 212 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG Q5QJ26_MYCAB 212 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG Q5QGG1_9MYCO 212 15 -
GGRALKFYSSVRLEVRKTETLKSGQEVVG RECA_SYMTH 213 15 -
GGNALKFYASIRLDIRRIGAIKDRDNVVG RECA_RHOCS 221 15 -
GGNALKFYASVRLDIRRTGAIKEGEEVIG RECA_PASMU 212 15 -
GGNALKFYASVRLDIRRVGSVKEGEEVVG RECA_HAHCH 210 15 -
GGKALKFYASVRLDVRRIETLKDGTEAVG A8L6J1_FRASN 211 15 -
GGNALKFYASVRLDIRRIGAVKNGEEIVG B6WZU4_9ENTR 212 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ18_9MYCO 213 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG Q5PXP6_LISSE 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG RECA_LISWE 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG RECA_LISW6 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG RECA_LISSE 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG RECA_LISIV 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG Q5S3P5_LISWE 209 15 -
GGNALKFYASVRLDIRRVGSIKEGDEVIG RECA_ACTAC 212 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ22_9MYCO 213 15 -
GGNALKFYATQRLDIRRIGAIKDGDQVIG A7H7H5_ANADF 214 15 -
GGNALKFYASVRLDIRRSGVVKDGDEVIG A7JUT5_PASHA 225 15 -
GGNALKFYASVRLDIRRSGVVKDGDEVIG RECA_PASHA 225 15 -
GGRALKFYASVRIDIRRIETLKDGTEAVG RECA_STRRM 211 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG B8DFS9_LISMO 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG RECA_LISMO 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG RECA_LISMF 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG RECA_LISIN 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG Q8G906_LISMO 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG Q547E3_LISMO 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG Q540Q2_LISIN 209 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG Q4EGT3_LISMO 209 15 -
GGNALKFYASVRLDIRRVGSIKDRDMIVG RECA_BARQU 209 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG A6AW11_VIBHA 210 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG A7MYT7_VIBHB 217 15 -
GGNALKFYASVRMEIRRVGAIKDRDEVVG A4U369_9PROT 221 15 -
GGRALKFYSSVRLEVRRIDSIKNGQEIIG B1CBR0_9FIRM 218 15 -
GGNALKFYASVRVDVRRIATLKQGESQIG RECA_NITSB 211 16 -
GGKALKFYASVRLDVRRIETLKDGSDAVG RECA_NOCFA 213 15 -
GGNALKFYCSVRLDIRKIETIKEKEESVG RECA_LEPIC 226 15 -
GGNALKFYCSVRLDIRKIETIKEKEESVG RECA_LEPIN 226 15 -
GGNALKFYASVRLDIRRIGAIKDRDEVVG A4EKT9_9RHOB 223 15 -
GGNALKFYASVRLDIRRIGQVKEGDEIIG RECA_ACICA 210 15 -
GGNALKFYSSVRLDIRRVGAVKDGDEIIG RECA_MANSM 212 15 -
GGNALKFYASVRLDIRRTGSIKEGDEVVG A6D4F1_9VIBR 210 15 -
GGKALKFYASVRLDIRRIETLKDGTDAVG B0RGY9_CLAMS 255 15 -
GGKALKFYASVRLDIRRIETLKDGTDAVG RECA_CLAM3 212 15 -
GGRALKFYSSVRLDVRKIDTIKQGDKVIG RECA_CLOD6 212 15 -
GGNALKFYASVRLDIRKVESIKQGQDVTG RECA_HERA2 211 15 -
GGNALKFYSSVRLDIRRIGAVKDRDEIVG A3XAW9_9RHOB 220 15 -
GGRALKFYSTVRLEVRRAEXLKQGTDVMG Q8GNQ3_LISMO 209 15 -
GGRALKFYASVRLDVRRIESLKDGTDVVG RECA_SALAI 212 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG A3LE75_PSEAE 210 15 -
GGRALKFYSSVRLDVRKIDTIKQGDKILG B0AAJ2_9CLOT 212 15 -
GGNALKFYSSVRLDIRRIGALKDRDEVVG A9GSY4_9RHOB 223 15 -
GGNALKFYASVRLDIRRSAAIKDGQEVVG A8ZY66_DESOH 211 15 -
GGNALKFYSSVRMDIRRIGAIKNGDEIIG Q4FMX8_PELUB 202 15 -
GGNALKFYASVRLDIRRIATLKQNDESIG RECA_CAMHC 211 16 -
GGNALKFYSSVRMDIRRIGAIKNGDEIIG Q1V252_9RICK 227 15 -
GGRALKFYSSVRLEVRRAETLKQGNDMIG A8VT65_9BACI 209 15 -
GGRALKFYSSVRLDVRKIDTIKQGDKVLG B6FZD0_9CLOT 212 15 -
GGRALKFYSSVRLEVRRAEQLKQGQDIVG RECA_STAEQ 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQDIVG RECA_STAES 210 15 -
GGRALKFYASVRLDVRRIESLKDGTDVVG RECA_SALTO 212 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG Q2FHF3_STAA3 185 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAW 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAU 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAT 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAS 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAR 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAN 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAM 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAE 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAC 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAAB 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAA9 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAA2 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAA1 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG Q2FZ09_STAA8 185 15 -
GGRALKFYSSVRLEVRRAEQLKQGQDIVG B9CVM8_STACP 210 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG RECA_MYCGI 213 15 -
GGKALKFYASIRLDVRRIDTIKEGQEAIG RECA_ACIC1 212 15 -
GGRALKFYATIRLDVRKVDNIKQGNEIVG B7R8S2_9THEO 209 15 -
GGRALKFYATIRLDVRKVDNIKQGNEIVG RECA_THETN 210 15 -
GGKALKFYASVRMDIRRIQTIKNGDEAVG A1A272_BIFAA 242 15 -
GGKALKFYASVRMDIRRIQTIKNGDEAVG A7A8C4_BIFAD 228 15 -
GGNALKFYASVRLDIRRTGVVKDGDNIIG B9CWV3_9PAST 226 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAHJ 210 15 -
GGNALKFYSSVRLDIRRIGSVKDRDEIVG B5IXK8_9RHOB 222 15 -
GGRALKFYSSVRMDVRRIEALKQGGEVVG B7BZK5_9FIRM 223 15 -
GGRALKFYASVRLDIRRIDSIKQGDSIIG B1QSG2_CLOBU 213 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG Q5QJ29_MYCCH 212 15 -
GGRALKFYSSVRIEVRRIESLKKGNDIIG B2A3V4_NATTJ 209 15 -
GGRALKFYASVRIDIRRIETLKDGTDAVG B5G7B0_9ACTO 211 15 -
GGNALKFYSSVRLDIRRTGSVKQGDEAIG RECA_CHRSD 212 15 -
GGNALKFYSSVRLDIRRIGSVKDGDEVVG RECA_MARAV 210 15 -
GGNALKFYSSVRLDIRRIGAVKDGDEVIG B8KSF1_9GAMM 210 15 -
GGRALKFYASVRLDVRRTETLKQGGEMVG A5ZPC8_9FIRM 212 15 -
GGNALKFYASVRLDIRRIGAIKEGDEVVG RECA_AERHH 210 15 -
GGNALKFYSSVRLDIRRIGAVKEGDEVVG B8KI12_9GAMM 210 15 -
GGRALKFYSTVRLEVRRAEQLKQGTDVMG Q8GNQ2_LISMO 209 15 -
GGNALKFYASVRLDIRRIGSIKDKEEVVG A0L826_MAGSM 221 15 -
GGKALKFYSSVRMDIRRIQTIKNGDEAVG B6XTI1_9BIFI 228 15 -
GGNALKFYASVRLDIRRTGAVKDGDEVVG RECA_ALISL 210 15 -
GGRALKFYSSIRLDVRRIETLKQAGDMVG B0MJ53_9FIRM 212 15 -
GGNALKFYASQRLDIRRIGAIKDGDSVIG B4UGJ8_ANASK 214 15 -
GGRALKFYSSVRLDVRKIDTIKQGQDVIG B7B4G1_9FIRM 223 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG Q2C123_9GAMM 210 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG Q1ZN94_9VIBR 210 15 -
GGRALKFYATIRLDVRKVDAIKQGNEIIG B0K1B8_THEPX 209 15 -
GGRALKFYATIRLDVRKVDAIKQGNEIIG B0K9N2_THEP3 209 15 -
GGNALKFYASVRLDVRKIATLKQNEEPIG RECA_CAMJD 211 16 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG A6B6D9_VIBPA 217 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_VIBPA 210 15 -
GGRALKFYSSVRLDVRRIDSIKQGDQILG B1II35_CLOBK 217 15 -
GGRALKFYSSVRLDVRRIDSIKQGDQILG B1KWJ3_CLOBM 217 15 -
GGNALKFYASVRLDIRRTGSIKEGDEAVG RECA_VIBAN 210 15 -
GGKALKFYSSVRLDVRRIETLKDGTDAVG Q5QJ24_MYCCH 212 15 -
GGRALKFYSSVRLDVRRIDSIKQGDQILG A5I4H9_CLOBH 214 15 -
GGRALKFYSSVRLDVRRIDSIKQGDQILG B1QQ14_CLOBO 217 15 -
GGRALKFYSSVRLDVRRIDSIKQGDQILG B1QEE3_CLOBO 217 15 -
GGRALKFYSSVRLDVRRIDSIKQGDQILG A7GFZ2_CLOBL 214 15 -
GGRALKFYSSVRLDVRRIDSIKQGDQILG A7FVX9_CLOB1 214 15 -
GGNALKFYSSVRLDIRRIGAVKEGDEVIG A4AAD1_9GAMM 210 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_VIBVY 210 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_VIBVU 210 15 -
GGKALKFYASVRLDIRRIETLKDGTDAVG A4AHJ3_9ACTN 212 15 -
GGNALKFYASVRLDIRRTGSIKEGDEVVG B8K904_VIBPA 225 15 -
GGNALKFYSSVRLDIRRIGAIKDRDEVVG Q28QV9_JANSC 223 15 -
GGNALKFYASMRLDIRKSGSIKSGQDVIG RECA_SYNAS 213 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG B9DPC5_STACA 210 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q5QJ20_9MYCO 213 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG A3UV42_VIBSP 210 15 -
GGNALKFYASQRLDIRRIGAIKDGDSVIG B8J9N8_9DELT 214 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q5QJ27_9MYCO 213 15 -
GGRALKFYASVRMDIRRIGALKAGNETVG RECA_RUBXD 210 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q5QJ34_9MYCO 213 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q5QJ32_9MYCO 213 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICB8 211 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICBR 211 15 -
GGRALKFYSSIRLEVRRLEALKQGAETVG B1I314_DESAP 210 15 -
GGRALKFYASVRLEVRRAEQIKQGNDMVG B1SQM1_9BACI 143 15 -
GGRALKFYSSVRMDVRRIDSIKQGDTMVG A5N856_CLOK5 213 15 -
GGRALKFYSSVRMDVRRIDSIKQGDTMVG B9E1L6_CLOKL 213 15 -
GGNALKFYASVRLDIRRIGAIKEGDEVVG RECA_AERSA 210 15 -
GGNALKFYASVRLDIRRTGSIKRGEEIVG RECA_NITEC 211 15 -
GGRALKFYSSVRLEVRRAEQLKQGQEIVG RECA_STAS1 210 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG Q1V5N0_VIBAL 210 15 -
GGNALKFYASVRLDIRRVGAVKEGEEVIG B3PJB8_CELJU 215 15 -
GGNALKFYSSVRLDVRRIATLKQGDKEVG A6DBB8_9PROT 211 16 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q5QJ17_9MYCO 213 15 -
GGNALKFYASVRLDVRKVATLKQNEEPIG A3YK12_CAMJE 211 16 -
GGRALKFYSSVRLEVRRAEALKNGTDIVG RECA_EXIS2 209 15 -
GGNALKFYASVRLDVRKVATLKQNEEPIG RECA_CAMJR 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG RECA_CAMJJ 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG RECA_CAMJE 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG RECA_CAMJ8 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG B5QFR3_CAMJE 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG A5KEY5_CAMJE 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG A3ZFZ0_CAMJE 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG A3ZD29_CAMJE 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG A3YT62_CAMJE 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG Q4HE44_CAMCO 211 16 -
GGRALKFYSSVRLDVRRVETLKDGSEMVG A5X9E4_PROAC 212 15 -
GGNALKFYSSVRMDIRRIGAIKDKDEIIG A4GJZ1_9BACT 227 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG A8GTM6_RICRS 230 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG B0BV65_RICRO 230 15 -
GGRALKFYSSIRLDVRRIEALKLGGDIVG A9KLQ6_CLOPH 212 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICFE 211 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICTY 211 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICPR 211 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICM5 211 15 -
GGKALKFYASVRLDVRRIETLKDGTDAVG Q5QJ23_MYCPR 213 15 -
GGKALKFYASVRMDIRRIQTIKNGDEAVG B1S8G9_9BIFI 294 15 -
GGNALKFYCSIRLDIRKIETIKEKEESVG Q04T44_LEPBJ 226 15 -
GGNALKFYCSIRLDIRKIETIKEKEESVG Q051G6_LEPBL 226 15 -
GGNALKFYASVRLDIRRTGAVKDGDEVVG A0Z6J8_9GAMM 210 15 -
GGNALKFYASVRLDIRRTGSIKRGEEMVG RECA_NITEU 211 15 -
GGNALKFYSSVRLDIRRIGSVKQGDEVIG A6W1Q4_MARMS 213 15 -
GGRALKFYASVRLDVRKVEQLKAGTEIVG Q2RJJ6_MOOTA 215 15 -
GGKALKFYASIRLDVRRIETLKDGTEAVA A8L0T0_FRASN 211 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG RECA_MYCSJ 213 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG RECA_MYCSS 213 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG RECA_MYCSK 213 15 -
GGNALKFYASVRLDVRKTATLKQNDEPIG Q83TZ0_CAMLA 211 16 -
GGNALKFYASVRLDVRKTATLKQNDEPIG Q845T1_CAMLA 211 16 -
GGRALKFYATVRLEVRRAEQLKNGTDIVG Q6KCJ2_9ENTE 210 15 -
GGNALKFYSSVRLDIRRIGAVKDGDEVVG B7RWK5_9GAMM 210 15 -
GGRALKFYSSVRLDVRRVETLKDGSEMVG Q5IV60_PROAC 212 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICCK 211 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG A8GPU6_RICAH 230 15 -
GGRALKFYASVRMDVRRIETLKDGTEAVG Q47RS6_THEFY 1013 372 -
GGKALKFYSSVRLDVRRIETLKDGSDAVG RECA_SACEN 212 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG Q1Z485_PHOPR 210 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q2M4U6_9MYCO 213 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q5QJ21_9MYCO 213 15 -
GGKALKFYASVRLDIRRIQTLKNGDEAVG B3DR86_BIFLD 249 15 -
GGKALKFYASVRLDIRRIQTLKNGDEAVG RECA_BIFLO 228 15 -
GGKALKFYASVRLDIRRIQTLKNGDEAVG RECA_BIFBR 228 15 -
GGKALKFYASVRLDIRRIQTLKNGDEAVG B9AW73_BIFBR 250 15 -
GGKALKFYASVRLDIRRIQTLKNGDEAVG B7GQG8_BIFLI 249 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG Q2M4U5_9MYCO 213 15 -
GGRALKFYSSVRLDVRRVETLKDGSEMVG Q2QJS7_PROAC 212 15 -
GGRALKFYSSVRLDVRRVETLKDGSEMVG RECA_PROAC 212 15 -
GGRALKFFSSVRMDIRRIDSIKVNGDVVG B9CKI0_9ACTN 225 15 -
GGNALKFYASVRLDIRRTGSIKKSDEVIG A8PQD9_9COXI 213 15 -
GGRALKFYATVRLEVRRAEQLKNGTDIVG Q6KCJ0_9ENTE 210 15 -
GGRALKFYATVRLEVRRAEQLKNGTDIVG Q6KCJ1_9ENTE 210 15 -
GGRALKFYATVRLEVRRAEQLKNGTDIVG Q6KCK1_9ENTE 210 15 -
GGRALKFYATVRLEVRRAEQLKNGTDIVG Q6KCJ4_9ENTE 210 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG Q7P9T0_RICSI 211 15 -
GGNALKFYSSVRLDVRRIATLKQADKEVG B9L7U2_9PROT 211 16 -
GGNALKFYSSVRMDIRRIGAIKDKDEIIG B6BSI6_9RICK 227 15 -
GGKALKFYASVRMDVRRIETLKDGTNAVG RECA_MYCMM 212 15 -
GGNALKFYSSVRLDVRKTATLKQNDEPIG B9KEN1_CAMLA 211 16 -
GGNALKFYSSVRIDIRKIGSIKDKEDVVG Q2GDN2_NEOSM 206 15 -
GGRALKFYASVRLEVRKGEIIKSQGQPIG B9MQY3_ANATH 211 15 -
GGNALKFYSSVRLDIRRIGSVKAGDEIIG A6VKZ3_ACTSZ 220 15 -
GGRALKFYASVRLDVRRIETLKQGGEVTG A8RNZ1_9CLOT 235 15 -
GGNALKFYASVRLDIRRIGAVKSGDEIIG RECA_PSYWF 211 15 -
GGNALKFYASVRIDVRRIASLKQGEQHIG RECA_WOLSU 213 16 -
GGRALKFYSSVRVDIRRIAAIKDGDTVIG Q1IV37_ACIBL 214 15 -
GGRALKFYASVRLEVRKGEIIKQQGQPIG A4XLD6_CALS8 211 15 -
GGNALKFYASVRLDVRKIATLKQSDEPIG RECA_CAMFE 211 16 -
GGNALKFYASVRLDVRKIATLKQSDEPIG RECA_CAMFF 211 16 -
GGNALKFYASQRLDIRRIGAIKDGDSVIG Q2IGM0_ANADE 214 15 -
GGNALKFYASVRIDIRRIGSIKDKEEVIG RECA_RICCN 211 15 -
GGNALKFYASVRLDVRKIATLKQNDEPIG B9D2D4_WOLRE 211 16 -
GGNALKFYASVRLDIRRTGAVKDGDEVVG RECA_VIBF1 210 15 -
GGNALKFYASVRLDIRRTGAVKDGDEVVG RECA_VIBFM 210 15 -
GGKALKFYASVRMDVRRIETLKDGTNAVG RECA_MYCA1 212 15 -
GGKALKFYASVRMDVRRIETLKDGTNAVG RECA_MYCPA 212 15 -
GGNALKFYASVRLDIRRTGQIKVGEDVIG A5KTF3_9BACT 222 15 -
GGKALKFYASVRCDIRRIQTLKDGQDAIG RECA_CORGB 223 15 -
GGKALKFYASVRCDIRRIQTLKDGQDAIG RECA_CORGL 223 15 -
GGKALKFYASVRMDVRRIETLKDGTDAVG RECA_MYCVP 213 15 -
GGRALKFYSSVRIDVRRTEALKSGSEVIG A6NW33_9BACE 227 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG RECA_PHOPR 210 15 -
GGRALKFYATVRLEVRRSEQLKQGSDIVG Q6KCJ9_9ENTE 210 15 -
GGRALKFYSSVRLEVRRAEQLKQGQDIVG A7KJJ5_STAXY 210 15 -
GGRALKFYSSVRLDVRRVETLKDGSEMVG Q5IV56_PROAC 212 15 -
GGNALKFYASVRLDVRRITTIKSGDEAVG B7ATW2_9BACE 212 15 -
GGRALKFYATIRLEVRRSEQLKSGTDIIG Q6KCJ8_9ENTE 210 15 -
GGRALKFYASVRMEVRKQENIKQGTDIVG A4J5T8_DESRM 209 15 -
GGNALKFYASVRLDIRRIGQVKEGDEIVG B7H1V4_ACIB3 210 15 -
GGNALKFYASVRLDIRRIGQVKEGDEIVG RECA_ACIBY 210 15 -
GGNALKFYASVRLDIRRIGQVKEGDEIVG RECA_ACIBT 210 15 -
GGNALKFYASVRLDIRRIGQVKEGDEIVG RECA_ACIBS 210 15 -
GGNALKFYASVRLDIRRIGQVKEGDEIVG RECA_ACIBC 210 15 -
GGNALKFYASVRLDVRKTATLKQNDEPIG Q8VLF3_CAMLA 211 16 -
GGNALKFYASVRLDVRKVATLKQNEEPIG Q4HR02_CAMUP 211 16 -
GGNALKFYASVRLDIRRIGQVKEGDEIVG B7I9U0_ACIB5 210 15 -
GGRALKFYSSVRIEIRRGEAIRKGDDIVG B0S1D5_FINM2 214 15 -
GGNALKFYSSVRIDVRKIATLKQNDEPIG A7ZFN0_CAMC1 226 16 -
GGRALKFYATVRLEVRRAEQLKQGTDIVG RECA_ENTFA 210 15 -
GGNALKFYSSVRLDIRRIGSVKQGDEVVG A3YGX8_9GAMM 135 15 -
GGQALKFYASVRMDIRRIETLKNGQETIG RECA_ROSCS 213 15 -
GGRALKFYASVRIDVRKAESMKEGSEVTG B5YEC6_DICT6 208 15 -
GGNALKFYASVRLDIRRIGSVKDGDEITG A6FHA2_9GAMM 210 15 -
GGNALKFYSSVRLDIRRIGSVKQGDEVVG A3YH37_9GAMM 216 15 -
GGRALKFYASVRIDVRKAESMKEGSEVTG B8E2U1_9BACT 208 15 -
GGNALKFYASVRMDIRRIGAVKNGDEIIG RECA_PSYA2 211 15 -
GGNALKFYASVRMDIRRIGAVKNGDEIIG RECA_PSYCK 211 15 -
GGNALKFYSSVRLDIRRVGSIKDKDSITG B6F2Z4_LIBAS 210 15 -
GGNALKFYSSVRLDVRRVGAIKNGEDVTG RECA_BDEBA 221 15 -
GGNALKFYATMRLDIRRVGPIKDGQEVVG RECA_SYNFM 213 15 -
GGNALKFYSSVRLDVRKTATLKQNDEPIG RECA_CAMLA 211 16 -
GGKALKFYASVRIDVRRIETLKEAGAPVG A7BD53_9ACTO 221 15 -
GGKALKFYASVRVDVRRIETLKDGANPVG B2GKH2_KOCRD 211 15 -
GGNALKFYCSVRIDVRRIATLKQGESQIG RECA_SULNB 213 16 -
GGKALKFYASVRMDVRRIETLKDGTNAVG RECA_MYCUA 212 15 -
GGNALKFYCSERLDIRRIGAIKDGQEITG RECA_DESPS 214 15 -
GGRALKFYATVRLEVRRAEQIKDGTDVIG RECA_LACBA 210 15 -
GGRALKFYSSVRIEVRKGEAIKQGTDLIG Q0AXJ0_SYNWW 215 15 -
GGRALKFYASVRMDVRRIDTLKMGGEIVG A7VB17_9CLOT 213 15 -
GGRALKFYATIRLEVRRAEQIKEGTNIIG Q6KCK4_9LACO 210 15 -
GGKALKFYASVRCDVRRIQTLKDGQDAIG RECA_CORDI 222 15 -
GGKALKFYASVRMDVRRIETLKDGVDAVG B8ZQT5_MYCLE 577 380 -
GGKALKFYASVRMDVRRIETLKDGVDAVG RECA_MYCLE 577 380 -
GGQALKFYASVRMDIRRIETLKNGQETIG RECA_ROSS1 213 15 -
GGRALKFYSSVRLEVRKVDTLKQGSDMIG RECA_HELMI 213 15 -
GGRALKFYATIRLEVRRAEQIKEGTNIIG Q6KC82_LACPL 210 15 -
GGRALKFYATIRLEVRRAEQIKEGTNIIG RECA_LACPL 210 15 -
GGRALKFYATIRLEVRRAEQIKEGTNIIG RECA_LACPE 210 15 -
GGRALKFYATIRLEVRRAEQIKEGTNIIG Q6KCK2_LACPL 210 15 -
GGNALKFYASVRLDIRRTGAVKEGEEVVG A4XPD2_PSEMY 210 15 -
GGNALKFYASVRLDIRRTGAVKEGEEVVG RECA_PSEOL 210 15 -
GGKALKFYASVRCDIRRIQALKDGQDVVG RECA_CORU7 220 15 -
GGNALKFYASVRLDIRRTSQIKDSDEVAG A6EIR5_9SPHI 212 15 -
GGKALKFYSSVRLDIRRIAQIKDGEEVVG RECA_CHLP8 225 15 -
GGNALKFYSSVRIDVRKIATLKQNEEPIG A7H0M6_CAMC5 226 16 -
GGTALKFYASMRLDIRKIDTLKEGQETTG B5YJG1_THEYD 211 15 -
GGKALKFYASVRCDIRRIQALKDGQDVVG RECA_CORJK 220 15 -
GGRALKFYSTVRLDIRRIGAIKDGDAVVG Q02AB1_SOLUE 212 15 -
GGNALKFYASVRLDIRRTGAIKEGDEVVG RECA_VIBNA 210 15 -
GGRALKFYSSVRLDIRRIKTIQQGDNMVG B6W918_9FIRM 214 15 -
GGQALKFYASVRLDIRRVETLKQGQEAIG B9LCN0_9CHLR 213 15 -
GGQALKFYASVRLDIRRVETLKQGQEAIG O52394 213 15 -
GGNALKFYASIRLDIRRIETLKEKEEPVG RECA_LEPME 223 15 -
GGKALKFYASVRIDVRRIQTLKDGQDAIG RECA_COREF 221 15 -
GGKALKFYASVRMDIRRIQTLKDKDEPIG B2E872_BIFAN 229 15 -
GGKALKFYASVRMDIRRIQTLKDKDEPIG B8DT97_BIFAN 229 15 -
GGNALKFYASVRLDIRRIQTLKKGTDEYG RECA_NOSP7 214 15 -
GGRALKFYASVRLDIRRVETIKQGTEAVG RECA_TROW8 214 15 -
GGRALKFYASVRLDIRRVETIKQGTEAVG RECA_TROWT 214 15 -
GGNALKFYASVRLDIRRTGAVKEGDEVVG A5L337_9GAMM 212 15 -
GGNALKFYASVRLDIRRATQLKDGEEVIG B5D1J8_9BACE 229 15 -
GGRALKFYSSVRMDVRRIETLKQSGEMVG A6BJF8_9FIRM 212 15 -
GGNALKFYSSVRLDIRRIGKIKQGDQVTG A6GK08_9DELT 222 15 -
GGRALKFYASVRMDVRRIETLKQGGEMIG B0G577_9FIRM 213 15 -
GGRALKFYATVRLEVRRAEQLKSGTDIIG Q6KCI8_9ENTE 210 15 -
GGNALKFYASVRMEIRRTGNIKDGDAVVG Q1DCC5_MYXXD 213 15 -
GGNALKFYASVRMEIRRTGNIKDGDAVVG REC1_MYXXA 213 15 -
GGNALKFYSSVRLDIRRIATLKQGENSIG RECA_ARCB4 211 16 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG A4KP48_FRATU 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRATW 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRATT 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRATO 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRATN 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRATM 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRATH 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRATF 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG RECA_FRAT1 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG B4AS14_FRANO 209 15 -
GGNALKFYASVRLDIRRIGAIKEAAAGGK A9GC15_SORC5 217 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG A7YR40_FRATU 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG A7JFJ7_FRANO 209 15 -
GGNALKFYSSVRLEVKKGGSIKDGIDVSG A7JEW1_FRATT 209 15 -
GGQALKFYASVRLDIRRIETLKQGQEAIG B8GAQ9_9CHLR 213 15 -
GGNALKFYASVRLEVRKGGSIKDGVDVSG RECA_FRAP2 209 15 -
GGRALKFYSTVRLEVRRAEQLKSGTDIIG Q6KCI7_9ENTE 210 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG A4N0Z4_HAEIN 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG RECA_HAEIN 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG RECA_HAEIG 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG RECA_HAEIE 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG RECA_HAEI8 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG A4NW53_HAEIN 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG A4NQP5_HAEIN 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG A4NNY3_HAEIN 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG A4NIB3_HAEIN 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG A4NCS2_HAEIN 212 15 -
GGNALKFYSSVRLDIRRTGSVKDGENIIG A4N6U0_HAEIN 212 15 -
GGKALKFYASVRCDVRRIQTLKDGQDAIG RECA_CORPS 222 15 -
GGNALKFYASVRIDVRRVATLKQNDQQIG RECA_HELHP 212 16 -
GGKALKFYASVRLDIRKIAQIKDGDEIVG A1BIQ4_CHLPD 223 15 -
GGRALKFYASVRMDVRRIETLKQSGEMVG A7B2G7_RUMGN 211 15 -
GGLALKFYSSVRLDIRRIESIKKGDEILG B1GYL2_UNCTG 212 15 -
GGRALKFYATIRLEVRRAEQLKQGTDIVG Q6KCI5_9ENTE 210 15 -
GGRALKFYATIRLEVRRAEQLKQGTDIVG Q6KCJ7_9ENTE 210 15 -
GGNALKFYASVRLDIRRSTQIKDSNGEVQ A3XGX2_9FLAO 213 15 -
GGRALKFYATIRLEVRRAEQLKQGTDIVG RECA_ENTHR 210 15 -
GGNALKFYSSVRLDIRRIGSVKEGDVVVG RECA_BAUCH 212 15 -
GGRALKFYATIRLEVRRAEQLKSGTDIIG Q6KCI6_9ENTE 210 15 -
GGNALKFYASVRLDIRRIQTLKKGTEEFG A0ZKA5_NODSP 214 15 -
GGRALKFYASVRMDVRRVETLKTGGEMVG A5Z6J3_9FIRM 250 15 -
GGRALKFYATIRLEVRRAEQLKQGTDIVG Q3Y1B9_ENTFC 210 15 -
GGRALKFYATIRLEVRRAEQLKQGTDIVG RECA_ENTFC 210 15 -
GGKALKFYSSVRLDIRKIAQLKDGDELTG RECA_CHLCH 225 15 -
GGNALKFYASVRLDIRKIGTIKDGDIIIG RECA_WIGBR 212 15 -
GGNALKFYASIRLDIRRIETLKEKEEPVG RECA_LEPBA 223 15 -
GGNALKFYASIRLDIRRIETLKEKEEPVG RECA_LEPBP 223 15 -
GGRALKFYSTVRMEVRRSEAIKAKSEIIG Q1WT13_LACS1 221 15 -
GGNALKFYASVRLDIRRTGAIKDGDEVVG A8T9B8_9VIBR 210 15 -
GGHALKFYASVRMDIRRIGQVKEGDAVVG B8J6W0_9DELT 186 15 -
GGRALKFYSTVRLEVRRAEQIKQSGDVLG RECA_LACAC 211 15 -
GGRALKFYASIRMDVRRIETLKQGGEMVG B7BJM4_9CLOT 212 15 -
GGRALKFYATIRLEVRRAEQLKQGTDIVG Q6KCI9_9ENTE 210 15 -
GGHALKFYASVRMDIRRIGQVKEGDAVVG B4UDA1_ANASK 213 15 -
GGRALKFYSSIRLDVRRTETLKQAGEMIG B0NZS5_9CLOT 212 15 -
GGRALKFYASIRMDVRRIETLKQSGEMVG B0ND63_EUBSP 212 15 -
GGRALKFYSSVRMEIRKTQTLKNGDEIVG B8CXC0_9FIRM 214 15 -
GGRALKFFSSVRIDIRRIESIKIKDEIVG B6GBT7_9ACTN 226 15 -
GGRALKFYASVRMDVRRIETLKQNGEIVG B5CR08_9FIRM 223 15 -
GGKALKFYSSVRLDIRKIAQIKDGEELVG O52393 224 15 -
GGNALKFYASVRLDIRSIGKLKDGDDIKG A7ACC2_9PORP 229 15 -
GGNALKFYASVRLDIRSIGKLKDGDDIKG B7B7E3_9PORP 229 15 -
GGRALKFYATIRLEVRRAEQLKQGTDIVG RECA_ENTMU 210 15 -
GGKALKFYASIRLDIRKIAQIKDGDEIVG RECA_CHLL2 225 15 -
GGNALKFYASVRLDIRKATAIKDGDEVIG B9ANW3_9BACT 221 15 -
GGNALKFYASVRLDIRRRTQIKDGDRVIG A4BXB3_9FLAO 215 15 -
GGNALKFYASIRMEIRKVSPIKDKEEVIG B3CT01_ORITI 208 15 -
GGNALKFYASVRLDIRRIQTLKKGTDEFG RECA_ANASP 214 15 -
GGNALKFYASVRLDIRRIQTLKKGTDEFG RECA_ANAVA 214 15 -
GGRALKFYSSVRIDIRRIETLKAGGEMIG A7VTT9_9CLOT 229 15 -
GGNALKFYASVRLDIRRSTQLKDGEEVIG A6L2X2_BACV8 227 15 -
GGNALKFYASVRLDIRRSTQLKDGEEVIG B6W2A9_9BACE 227 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG B5IPP8_9CHRO 250 15 -
GGSALKFYTSIRLDIRKVSAIKDKDNVIG B9KHJ1_ANAMF 219 15 -
GGRALKFYASVRMDVRRIETLKQNGEMVG B6FS94_9CLOT 219 15 -
GGRALKFYSTIRMEIRRAEQIKNGTDVIG B3XRC0_LACRE 210 15 -
GGRALKFYSTIRMEIRRAEQIKNGTDVIG RECA_LACRJ 210 15 -
GGRALKFYSTIRMEIRRAEQIKNGTDVIG RECA_LACRD 210 15 -
GGRALKFYSTVRLEVRRAETIKNGTDMIG RECA_LACSS 211 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG Q05QA7_9SYNE 224 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_SYNPW 224 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_SYNS3 224 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG A3YUM4_9SYNE 232 15 -
GGNALKFYASVRLDIRRSTQIKDTDSNVM A6ELL5_9BACT 215 15 -
GGRALKFYSTIRLEVRRAEQLKSGTDIIG RECA_ENTGA 210 15 -
GGQALKFYASVRLDIRRIQTLKKGTEEYG RECA_SYNE7 216 15 -
GGQALKFYASVRLDIRRIQTLKKGTEEYG RECA_SYNP6 216 15 -
GGRALKFFSSVRIDIRRIESIKVKDEIVG B6G4X5_9ACTN 226 15 -
GGKALKFYASVRIDVRRIQTLKEGADSVG B8HG89_9MICC 212 15 -
GGKALKFYASVRIDVRRIQTLKEGADSVG RECA_ARTAT 212 15 -
GGNALKFYASVRLDIRRSTQIKDTDGAVR A4ANZ6_9FLAO 233 15 -
GGNALKFYASIRMEIRKVSPIKDKEEVIG A5CCL6_ORITB 208 15 -
GGKALKFYSSIRLDIRKIAQLKDGDEIIG Q3B668_PELLD 223 15 -
GGSALKFYTSIRLDIRKVSAIKDKDNVIG RECA_ANAMM 219 15 -
GGNALKFYASVRLDIRRIQTLKKGTDMFG B0C5Y5_ACAM1 214 15 -
GGNALKFYSSVRLDIRKVSAIKDKDVIIG RECA_EHRRG 216 15 -
GGNALKFYSSVRLDIRKVSAIKDKDVIIG RECA_EHRRW 216 15 -
GGNALKFYASVRLDIRGSQQIKDGEEVIG Q5LG39_BACFN 198 15 -
GGNALKFYASVRLDIRGSQQIKDGEEVIG RECA_BACFR 198 15 -
GGNALKFYASVRLDIRRSQTLKRGTEEYG B1X512_PAUCH 219 15 -
GGNALKFYASVRLDIRRTGSIKEGDDVIG A9M4P2_9VIBR 224 14 -
GGNALKFYASVRLDIRGSQAIKNGDEVIG A7VAG0_BACUN 225 15 -
GGNALKFYASVRIDIRRIAALKQNEQHIG RECA_HELAH 213 16 -
GGNALKFYASVRLDIRSIGKLKDGDEIKG A6LBZ5_PARD8 230 15 -
GGRALKFYASVRIDIRRTASIKDGEEVIG A8DJT2_9BACT 213 15 -
GGNALKFYASVRLDIRRIQTLKKGTDMYG A8ZPF7_ACAM1 214 15 -
GGRALKFYSSVRMDIRRIGAVKDGQDVVG Q2S2C8_SALRD 214 15 -
GGNALKFYSSVRLDIRRSTQIKNTDGDVQ A4CHW1_9FLAO 213 15 -
GGNALKFYASVRLDIRRRTQIKDGDRVIG A2TYC4_9FLAO 215 15 -
GGNALKFYASVRLDIRKGQPIKDGEDIIG B3JNC6_9BACE 228 15 -
GGHALKFYASVRLDIRRIGQVKDGDQVVG A7HGT3_ANADF 213 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG A3Z8Y2_9SYNE 220 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG A4CSK9_SYNPV 224 15 -
GGNALKFYASVRLDIRGSQAIKDGEEVLG A5ZGP0_9BACE 225 15 -
GGKALKFYASVRIDVRRIQTLKEGADSVG A9WQ43_RENSM 247 15 -
GGNALKFYASVRLDIRRSTQIKDSANNVM A0M6E4_GRAFK 215 15 -
GGRALKFYSTIRLEVRRAEQIKQSGDVIG A8YUB7_LACH4 211 15 -
GGNALKFYASVRLDIRRIQTLKKGTDMYG A8ZLV5_ACAM1 214 15 -
GGNALKFYSSVRLEIRRTGNLKEGESIIG Q09CN8_STIAU 186 15 -
GGKALKFYASIRIDVRRIQTLKEGADSVG B0BKA0_9MICC 212 15 -
GGRALKFYSTIRLEVRRAEQIKQSTNVIG RECA_LACDA 211 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRPG 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRPC 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRPB 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRP8 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRP6 224 15 -
GGRALKFYSTIRLEVRRAEQIKQSTNVIG RECA_LACDB 211 15 -
GGNALKFYASVRMDIRRIESIKEGDQVLG A3EWF7_9BACT 215 15 -
GGNALKFYSSMRIDIRRISTIKDGDEMIG Q1NP94_9DELT 213 15 -
GGNALKFYASVRLDIRGGQAIKNGEEVIG B0NNH2_BACSE 225 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEQKD RECA_STRMU 224 15 -
GGNALKFYASVRLDIRGGQAIKNGEEVIG B7AIA5_9BACE 225 15 -
GGNALKFYASVRIDIRGSQPIKDGEEVLG RECA_BACTN 211 15 -
GGRALKFYASVRMDVRKTETLKQSGEMVG A5KKH5_9FIRM 213 15 -
GGKALKFYSSIRLDIRRIAQLKDGDEIIG Q0YRU2_9CHLB 224 15 -
GGRALKFFSSVRIDIRRIDSIKLKDEVIG A4EC83_9ACTN 204 15 -
GGNALKFYASVRLDIRRIQTLKKGTEMYG B0CCZ6_ACAM1 214 15 -
GGNALKFYASVRLDIRRIQTLKKGTEEFG RECA_SYNPX 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE A5LEG8_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE RECA_STRR6 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE RECA_STRPS 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE RECA_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE RECA_STRPI 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE RECA_STRP4 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE RECA_STRP2 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE B8ZNU7_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE B2E6T2_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE B2E1Y3_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE B2DVL7_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE B2DQY6_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE B2DKH8_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE B1S2Q9_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE A5MWD5_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE A5MPK3_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE A5MHL6_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE A5MA70_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE A5M2X0_STRPN 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKE A5LTW1_STRPN 224 15 -
GGHALKFYASVRMDIRRIGQVKEGDAVVG Q2IFM8_ANADE 186 15 -
GGRALKFYSTIRLEVRRAEQIKQSGDMIG A4UAE2_LACHE 211 15 -
GGRALKFYASVRLDVRRIDTLRQGGEIVG A8SPJ7_9FIRM 220 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKD B9DW65_STRUB 224 15 -
GGNALKFYSSVRLDIRKASAIKDGDEVKG B6YQ33_AZOPC 225 15 -
GGKALKFYASIRIDVRRIQTLKEGADSVG RECA_ARTS2 212 15 -
GGNALKFYSSVRLDIRKVSAIKDKDVIIG Q40IG8_EHRCH 216 15 -
GGNALKFYSSVRLDIRKVSAIKDKDVIIG RECA_EHRCR 216 15 -
GGRALKFYATVRLEIRRSEQIKTGADVVG B3WCM1_LACCB 211 15 -
GGRALKFYATVRLEIRRSEQIKTGADVVG Q03AQ0_LACC3 211 15 -
GGNALKFYASVRIDIRRIAALKQNEQHIG RECA_HELPH 213 16 -
GGNALKFYASVRIDIRRIAALKQNEQHIG RECA_HELPS 213 16 -
GGNALKFYASVRMDIRRIESIKEGDQVLG B6ANE8_9BACT 215 15 -
GGNALKFYASVRLDIRGSQAIKNGDEVLG B3CCX8_9BACE 225 15 -
GGNALKFYASVRLDIRRSTQIKDTSGSVL Q26HA5_9BACT 185 15 -
GGRALKFYSSVRLDVRGNTQIKGTGDQKD B1SCW6_9STRE 232 15 -
GGNALKFYASVRLDIRRSTQIKDGENVLG A6H1S7_FLAPJ 213 15 -
GGNALKFYASVRIDIRRIASLKQNEQHIG RECA_HELPY 213 16 -
GGNALKFYASVRLDIRKAETLKKGQDEYG RECA_GLOVI 227 15 -
GGRALKFYSTIRLEVRRAEQIKQGSDVIG Q042C2_LACGA 211 15 -
GGRALKFYSTIRLEVRRAEQIKQGSDVIG RECA_LACJO 211 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROM1 227 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROMT 227 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD Q3CZB3_STRAG 224 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD RECA_STRA5 224 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD RECA_STRA3 224 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD Q9F5P5_STRAG 185 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD Q3JYN1_STRA1 185 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD Q3DQA1_STRAG 224 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD Q3DGG0_STRAG 224 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD Q3DA70_STRAG 224 15 -
GGNALKFYASVRIDIRRIASLKQNEQHIG RECA_HELPG 213 16 -
GGNALKFYASVRLDIRPGQPIKDGEEILG B6WDW6_9BACE 225 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROMA 229 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STREM 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRPM 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRP1 224 15 -
GGNALKFYASVRLDIRRIQTLKKGTEEFG RECA_SYNSC 222 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG B9NYQ8_PROMA 218 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROMS 218 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROM9 218 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROM2 218 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROM0 218 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG Q1PK73_PROMA 218 15 -
GGNALKFYASVRLDIRGSQPIKDGEEILG A7M5K6_BACOV 225 15 -
GGRALKFYASVRIDIRRAEQLKQGDGEPY A8SMT5_9FIRM 227 19 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROM5 223 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROMP 223 15 -
GGNALKFYASVRLDIRRTQTLKKGSDEYG B5W6W4_SPIMA 214 15 -
GGNALKFYASVRLDIRRIGQIKESADSIL A3HWX3_9SPHI 212 15 -
GGNALKFYSSVRLDIRKVSAIKDKDLIIG RECA_EHRCJ 216 15 -
GGKALKFYSSVRLDIRKIAQIKDGEEITG B4SFE4_PELPB 223 15 -
GGRALKFYATIRLEVRRAEQIKDGADVIG Q03EQ5_PEDPA 210 15 -
GGNALKFYCSVRLDIRRSTQIKDSNSEVQ A3U6B8_9FLAO 215 15 -
GGRALKFYASVRLDVRGNTQIKGTGDQKD O85502 224 15 -
GGRALKYYASVRIDIRRVEGLKDSSGQFI A8S787_9FIRM 226 15 -
GGNALKFYASVRLDIRRIQTLKKGTEGEY RECA_SYNY3 213 15 -
GGNALKFYASVRLDIRRVQTLKKGTEEFG B8HR52_9CHRO 215 15 -
GGRALKFYASVRLDVRGNTQIKGTGDKKD RECA_STRT1 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDKKD RECA_STRTD 224 15 -
GGRALKFYASVRLDVRGNTQIKGTGDKKD RECA_STRT2 224 15 -
GGNALKFYASVRLDIRRSTQIKGTDGEVK A9DT53_9FLAO 215 15 -
GGNALKFYASVRLDIRRIQTLKRATEEYG A5GVV5_SYNR3 218 15 -
GGKALKFYASVRMDVRRVETLKDGTNAVG A1KM75_MYCBP 212 15 -
GGKALKFYASVRMDVRRVETLKDGTNAVG RECA_MYCTU 212 15 -
GGKALKFYASVRMDVRRVETLKDGTNAVG RECA_MYCBO 212 15 -
GGKALKFYASVRMDVRRVETLKDGTNAVG A5U689_MYCTA 212 15 -
GGKALKFYASVRMDVRRVETLKDGTNAVG A4KK14_MYCTU 212 15 -
GGKALKFYASVRMDVRRVETLKDGTNAVG A2VL74_MYCTU 212 15 -
GGKALKFYASVRMDVRRVETLKDGTNAVG A1QV11_MYCTF 212 15 -
GGRALKFYASVRIDIRRIGSIKDGDAIIG Q1PYI7_9BACT 219 16 -
GGNALKFYASVRIDVRRIASLKQGESQIG B6BH95_9PROT 211 16 -
GGNALKFYASVRLDIRRVQTLKKGAEEYG Q2JK85_SYNJB 210 16 -
GGNALKFYASVRLDIRRIQTLKKGTEEFG B0C288_ACAM1 215 15 -
GGRALKFYASVRLDVRGNTQIKGTGDEKD RECA_STRSV 224 15 -
GGNALKFYASVRIDIRRVSVIKDGEEQLG B0MSV9_9BACT 216 15 -
GGNALKFYASVRIDIRRIAALKQNEQHIG RECA_HELPJ 213 16 -
GGNALKFYTSVRLDIRKVGVIKDKENITG RECA_WOLPM 217 15 -
GGNALKFYASVRLDIRRIQTLKKGSEGEY B7JZS9_CYAP8 214 15 -
GGSALKFYTSIRLDIRKVSAIKDKDSVIG Q2EFY1_ANACE 217 15 -
GGNALKFYASVRIDIRRIAALKQNEQHIG Q8VLM8_HELPY 213 16 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROM3 229 15 -
GGNALKFYASVRLDIRRIQTLKRGTEEYG RECA_PROMM 229 15 -
GGNALKFYASVRIDIRRIASLKQNEQHIG RECA_HELP2 213 16 -
GGNALKFYASVRLDIRRSAQIKDGENVIG A5FLA2_FLAJ1 213 15 -
GGRALKFYASVRLDVRGNTQIKGTGDAKD RECA_STRGC 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRP3 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRPF 224 15 -
GGRALKFYASVRLDVRGTTQIKGTGDQKD RECA_STRPD 224 15 -
GGRALKFYASVRMDVRGNTQIKGTGDKKD A4VSE7_STRSY 163 15 -
GGRALKFYASVRMDVRGNTQIKGTGDKKD Q9KWG8_STRSU 185 15 -
GGRALKFYASVRMDVRGNTQIKGTGDKKD A4VYN5_STRS2 225 15 -
GGKALKFYSSIRLDIRRIAQLKDGDAIIG A4SD03_PROVI 224 15 -
GGNALKFYASVRLDIRRTQTLKKGSDEYG RECA_SPIPL 214 15 -
GGRALKFYSSVRIDLRRIETIKQGTIAVG A8CPQ2_9CHLR 211 15 -
GGRALKFYSSVRIDLRRIETIKQGTVAIG Q3Z648_DEHE1 211 15 -
GGNALKFYASVRLDIRRSTQIKDSNANVM A2TR45_9FLAO 213 15 -
GGRALKFYASVRLDVRGNNQIKGTGDQKI RECA_STRP9 224 15 -
GGKALKFYASVRLDIRKIAQIKDGTEIVG RECA_CHLT3 224 15 -
GGNTLKVYSPIRLEVKKGGSIKDGIDVSG A7JPI1_FRANO 210 16 -
GGNALKFYSSIRMDIRKIQTLKDKEEVYG B8DP00_DESVM 219 16 -
GGNALKFYASVRIDIRKSTQIKDGDNVLG A3J3B9_9FLAO 213 15 -
GGTALKFYASVRLDIRRIQTLKKGSEGEY RECA_CYAA5 214 15 -
GGKALKFYSSVRMEVKKMGTVKQGDDPIG A5TXF8_FUSNP 225 15 -
GGRALKFYSSVRLDVRGNTQIKGTGEHKD RECA_STRAG 224 15 -
GGKALKFYSSVRMEVKKMGTVKQGDDPIG RECA_FUSNN 225 15 -
GGNALKFYASVRLDIRRSTQIKDSNSNVM A8UIA5_9FLAO 213 15 -
GGNALKFYASVRLDVRKIETLGKDDDEAW RECA_TREDE 223 15 -
GGNALKFYSSVRMDIRKIQTLKDKEEVYG RECA_DESVH 219 16 -
GGNALKFYSSVRMDIRKIQTLKDKEEVYG RECA_DESVV 219 16 -
GGNALKFYTSIRLDIRKVGAIKDKENITG B6Y6M6_9RICK 217 15 -
GGNAL