SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00075

Identifier
FACDDSATRASE  [View Relations]  [View Alignment]  
Accession
PR00075
No. of Motifs
7
Creation Date
01-MAR-1995  (UPDATE 27-JUN-1999)
Title
Fatty acid desaturase family 1 signature
Database References

PROSITE; PS00476 FATTY_ACID_DESATUR_1
PFAM; PF01069 Desaturase
INTERPRO; IPR001522
Literature References
1. NTAMBI, J.M., BUHROW, S.A., KAESTNER, K.H., CHRISTY, R.J., SIBLEY, E.,
KELLY, T.J. AND LANE, M.D.
Differentiation-induced gene expression in 3T3-L1 preadipocytes.
Characterization of a differentially expressed gene encoding stearoyl-CoA
desturase.
J.BIOL.CHEM. 263 17291-17300 (1988).
 
2. STUKEY, J.E., MCDONOUGH, V.M. AND MARTIN, C.E.
The OLE1 gene of Saccharomyces cerevisiae encodes the delta 9 fatty acid
desaturase and can be functionally replaced by the rat stearoyl-CoA
desaturase gene,
J.BIOL.CHEM. 265 20144-20149 (1990).
 
3. THIEDE, M.A., OZOLS, J. AND STRITTMATTER, P.
Construction and sequence of cDNA for rat liver stearoyl coenzyme A
desaturase.
J.BIOL.CHEM. 261 13230-13235 (1986).

Documentation
Fatty acid desaturases are enzymes that insert double bonds in the delta
position of saturated fatty acids. There are 2 distinct enzyme families:
the first contains stearoyl-CoA desaturase (SCD); the second includes plant
stearoyl-acyl-carrier protein and cyanobacteria desA protein. SCD is an
essential enzyme in the synthesis of unsaturated fatty acids [1]: in
association with cytochrome b5 and NADP-dependent cytochrome b5 reductase,
it constitutes part of a microsomal membrane-bound 3-component system in
animals and fungi [1]. SCD contains 4 putative transmembrane (TM) regions
that anchor it in the microsomal membrane. 
 
The enzyme uses oxygen and electrons from reduced cytochrome b5 [2,3] to 
catalyse the insertion of a double bond between carbons 9 and 10 of a 
spectrum of fatty acids [1-3]. The preferred substrates of SCD are
palmitoyl-CoA and stearoyl-CoA, which are converted to palmitoleic (16:1)
and oleic (18:1) acids respectively [1,3]. These unsaturated molecules
are the major storage form of fatty acids (as triacylglycerols) in
adipocytes [1].
 
FACDDSATRASE is a 7-element fingerprint that provides a signature for
fatty acid desaturase family 1. The fingerprint was derived from an initial
alignment of 4 sequences: motifs 1, 2, 5 and 6 were drawn from the 4
putative TM regions, and motif 7 includes the region encoded by PROSITE
pattern FATTY_ACID_DESATUR_1 (PS00476), which spans a C-terminal aromatic/
His-rich domain. Two iterations on OWL25.1 were required to reach
convergence, at which point a true set comprising 7 sequences was
identified.
 
An update on SPTR37_9f identified a true set of 19 sequences, and 12
partial matches.
Summary Information
  19 codes involving  7 elements
7 codes involving 6 elements
4 codes involving 5 elements
1 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
719191919191919
63777477
50444044
40011011
30000000
20000000
1234567
True Positives
ACO1_MOUSE    ACO1_YEAST    ACO2_MOUSE    ACOD_HUMAN    
ACOD_MESAU ACOD_RAT O01708 O13378
O16918 O33722 O44390 O44428
O45892 O62849 P79049 Q27437
Q44502 Q92038 Q94541
True Positive Partials
Codes involving 6 elements
O07873 O15810 P79077 P79078
Q44117 Q55406 Q94824
Codes involving 5 elements
O65798 O80331 Q12618 Q12619
Codes involving 4 elements
O65797
Sequence Titles
ACO1_MOUSE  ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) (DELTA(9)-DESATURASE) - MUS MUSCULUS (MOUSE). 
ACO1_YEAST ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - SACCHAROMYCES CEREVISIAE (BAKER'S YEAST).
ACO2_MOUSE ACYL-COA DESATURASE 2 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 2) (FATTY ACID DESATURASE 2) (DELTA(9)-DESATURASE) - MUS MUSCULUS (MOUSE).
ACOD_HUMAN ACYL-COA DESATURASE (EC 1.14.99.5) (STEAROYL-COA DESATURASE) (FATTY ACID DESATURASE) (DELTA(9)-DESATURASE) - HOMO SAPIENS (HUMAN).
ACOD_MESAU ACYL-COA DESATURASE (EC 1.14.99.5) (STEAROYL-COA DESATURASE) (FATTY ACID DESATURASE) (DELTA(9)-DESATURASE) - MESOCRICETUS AURATUS (GOLDEN HAMSTER).
ACOD_RAT ACYL-COA DESATURASE (EC 1.14.99.5) (STEAROYL-COA DESATURASE) (FATTY ACID DESATURASE) (DELTA(9)-DESATURASE) - RATTUS NORVEGICUS (RAT).
O01708 VZK822L.1 PROTEIN - CAENORHABDITIS ELEGANS.
O13378 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - MUCOR ROUXII.
O16918 F10D2.9 PROTEIN - CAENORHABDITIS ELEGANS.
O33722 DELTA-9 DESATURASE - SPIRULINA PLATENSIS.
O44390 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - TRICHOPLUSIA NI (CABBAGE LOOPER).
O44428 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - TRICHOPLUSIA NI (CABBAGE LOOPER).
O45892 W06D12.3 PROTEIN - CAENORHABDITIS ELEGANS.
O62849 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - OVIS ARIES (SHEEP).
P79049 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (DELTA 9-FATTY ACID DESATURASE) - PICHIA ANGUSTA (YEAST) (HANSENULA POLYMORPHA).
Q27437 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - AMBLYOMMA AMERICANUM.
Q44502 FATTY-ACID DESATURASE - ANABAENA VARIABILIS.
Q92038 ACYL-COA DESATURASE (EC 1.14.99.5) (STEAROYL-COA DESATURASE) (FATTY ACID DESATURASE) (DELTA(9)-DESATURASE) - CYPRINUS CARPIO (COMMON CARP).
Q94541 FATTY ACID DESATURASE - DROSOPHILA MELANOGASTER (FRUIT FLY).

O07873 DELTA-9 DESATURASE - SYNECHOCOCCUS SP. (STRAIN PCC 7002) (AGMENELLUM QUADRUPLICATUM).
O15810 DELTA-9 FATTY ACID DESATURASE - TETRAHYMENA PYRIFORMIS.
P79077 DELTA-9 FATTY ACID DESATURASE (EC 1.14.99.5) (STEAROYL-COA DESATURASE) (ACYL-COA DESATURASE) (DELTA(9)-DESATURASE) - CRYPTOCOCCUS CURVATUS.
P79078 DELTA-9 FATTY ACID DESATURASE (EC 1.14.99.5) (STEAROYL-COA DESATURASE) (ACYL-COA DESATURASE) (DELTA(9)-DESATURASE) - CRYPTOCOCCUS CURVATUS.
Q44117 FATTY ACID DESATURASE - ANACYSTIS NIDULANS.
Q55406 ACYL-COA DESATURASE 1 - SYNECHOCYSTIS SP. (STRAIN PCC 6803).
Q94824 ACYL-COA DESATURASE (EC 1.14.99.5) (STEAROYL-COA DESATURASE) (FATTY ACID DESATURASE) (DELTA(9)-DESATURASE) - TETRAHYMENA THERMOPHILA.

O65798 DELTA 9 DESATURASE - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O80331 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - CYANIDIOSCHYZON MEROLAE.
Q12618 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - AJELLOMYCES CAPSULATA (HISTOPLASMA CAPSULATUM).
Q12619 ACYL-COA DESATURASE 1 (EC 1.14.99.5) (STEAROYL-COA DESATURASE 1) (FATTY ACID DESATURASE 1) - AJELLOMYCES CAPSULATA (HISTOPLASMA CAPSULATUM).

O65797 DELTA 9 DESATURASE - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
Scan History
OWL25_1    2  100  NSINGLE    
SPTR37_9f 3 100 NSINGLE
Initial Motifs
Motif 1  width=21
Element Seqn Id St Int Rpt
WRNIILMVLLHLGGLYGIILV ACO1_MOUSE 69 69 -
WLNMVLVCGMPMIGWYFALSG ACO1_YEAST 113 113 -
WTVIFFFTSIHLVALLAFLPQ SYCDES9 54 54 -
WRNIILMALLHVGALYGITLI ACOD_RAT 72 72 -

Motif 2 width=23
Element Seqn Id St Int Rpt
HLNVFLFSVFYYAVGGVSITAGY ACO1_YEAST 138 4 -
KLYTALFGIFYYMTSALGITAGA ACO1_MOUSE 93 3 -
WKAVGMAFLLYVITGGIGITLGF SYCDES9 78 3 -
KVYTLLWGIFYYLISALGITAGA ACOD_RAT 96 3 -

Motif 3 width=21
Element Seqn Id St Int Rpt
HRLWSHRTYKARLPLRIFLII ACO1_MOUSE 116 0 -
HRCISHRSFNVPKWLEYIFVI SYCDES9 101 0 -
HRLWSHRTYKARLPLRIFLII ACOD_RAT 119 0 -
HRLWSHRSYSAHWPLRLFYAI ACO1_YEAST 161 0 -

Motif 4 width=30
Element Seqn Id St Int Rpt
HRAHHKFSETHADPHNSRRGFFFSHVGWLL ACOD_RAT 156 16 -
HRIHHRYTDTLRDPYDARRGLWYSHMGWML ACO1_YEAST 198 16 -
HRMHHKFSDTTPDPHDSNKGFWWSHIGWMM SYCDES9 138 16 -
HRAHHKFSETHADPHNSRRGFFFSHVGWLL ACO1_MOUSE 153 16 -

Motif 5 width=19
Element Seqn Id St Int Rpt
NLILIQVALGLILFALGGW SYCDES9 195 27 -
YKPGLLLMCFILPTLVPWY ACOD_RAT 217 31 -
YKPGLLLMCFILPTLVPWY ACO1_MOUSE 214 31 -
YILLMLLTAFVIPTLICGY ACO1_YEAST 256 28 -

Motif 6 width=22
Element Seqn Id St Int Rpt
FIRVFVIQQATFCINSMAHYIG ACO1_YEAST 288 13 -
FVRLVFVFHFTWFVNSATHKFG SYCDES9 221 7 -
FLRYTLVLNATWLVNSAAHLYG ACOD_RAT 250 14 -
FLRYTLVLNATWLVNSAAHLYG ACO1_MOUSE 247 14 -

Motif 7 width=15
Element Seqn Id St Int Rpt
GEGFHNYHHAFPYDY ACOD_RAT 293 21 -
GEGYHNFHHEFPTDY ACO1_YEAST 331 21 -
GEGFHNYHHTFPFDY ACO1_MOUSE 290 21 -
GEGWHNNHHAYQYSA SYCDES9 264 21 -
Final Motifs
Motif 1  width=21
Element Seqn Id St Int Rpt
WRNIILMALLHVGALYGITLI ACOD_RAT 72 72 -
WRNIILMGLLHLGALYGITLI O62849 73 73 -
WRNIILMSLLHLGALYGITLI ACOD_HUMAN 73 73 -
WRNIILMALLHLGALYGITLV ACO2_MOUSE 72 72 -
WRNIILMVLLHLGGLYGIILV ACO1_MOUSE 69 69 -
WRNIILMALLHLGALYGLVLV ACOD_MESAU 68 68 -
WRNVILMSLLHLGALYGLFLF Q92038 44 44 -
WRNIIAFGYLHLAALYGAYLM Q94541 72 72 -
WRNVILMGMLHIGGVYGAYLF O44428 42 42 -
WRNVALFAALHFAAAIGLYQL O01708 49 49 -
WRNVALFAALHVAAAIGLYEL O16918 48 48 -
WRNVILMGSLHLISIYGFYLI Q27437 24 24 -
YTNFLTFSYAHLAALYGLYLC O44390 38 38 -
WKNVALFVALHIGALVGLYQL O45892 40 40 -
WPQAILLCVTPLIALYGIFTT O13378 46 46 -
WLNMVLVCGMPMIGWYFALSG ACO1_YEAST 113 113 -
WLNFILVLAVPFAGLISTKWV P79049 55 55 -
WVNTLFFLGLHIGALFAFIPS Q44502 13 13 -
WMTIVFMAFLHIGALFVLVPS O33722 13 13 -

Motif 2 width=23
Element Seqn Id St Int Rpt
KVYTLLWGIFYYLISALGITAGA ACOD_RAT 96 3 -
KIYTFLWVLFYYVISALGITAGV O62849 97 3 -
KFYTWLWGVFYYFVSALGITAGA ACOD_HUMAN 97 3 -
KLYTCLFAYLYYVISALGITAGA ACO2_MOUSE 96 3 -
KLYTALFGIFYYMTSALGITAGA ACO1_MOUSE 93 3 -
KVYTLLWAFVYYVISIEGIGAGV ACOD_MESAU 92 3 -
RALTWIWFFGCLLFSALGITAGA Q92038 68 3 -
KWQTCILAYFLYVISGLGITAGA Q94541 97 4 -
MWLTDLFAFFLYLCSGLGITAGA O44428 67 4 -
KWQTVIFTFLLYVFGGFGITAGA O01708 74 4 -
KWQTAVFSFALYVFSGFGITAGA O16918 73 4 -
QWKTVLAAYIFYTISGIGVTAGS Q27437 49 4 -
KWETLLFSFVLFHMSNIGITAGA O44390 63 4 -
KWATVGWVFLLHTLGSMGVTGGA O45892 65 4 -
TKKTLIWSWIYYFITGLGITAGY O13378 69 2 -
HLNVFLFSVFYYAVGGVSITAGY ACO1_YEAST 138 4 -
KLHTFVTAVILYCFGGISITAGY P79049 78 2 -
WAAVGVALLLYWITGGLGITLGF Q44502 37 3 -
WAAVGLALFLHWVTGGLGITLGF O33722 37 3 -

Motif 3 width=21
Element Seqn Id St Int Rpt
HRLWSHRTYKARLPLRIFLII ACOD_RAT 119 0 -
HRLWSHRTYKARLPLRVFLII O62849 120 0 -
HRLWSHRSYKARLPLRLFLII ACOD_HUMAN 120 0 -
HRLWSHRTYKARLPLRLFLII ACO2_MOUSE 119 0 -
HRLWSHRTYKARLPLRIFLII ACO1_MOUSE 116 0 -
HRLWSHRTYKARLPLRIFLII ACOD_MESAU 115 0 -
HRLWSHRSYKASLPLQIFLAL Q92038 91 0 -
HRLWAHRSYKAKWPLRVILVI Q94541 120 0 -
HRLWAHKSYKARLPLRLLLTL O44428 90 0 -
HRLWSHKSYKATTPMRIFLMI O01708 97 0 -
HRLWSHKSYKATTPMRIFLML O16918 96 0 -
HRLWSHRSYKAKLPYRIMLMI Q27437 72 0 -
HRLWTHKTFKAKLPLEIVLMI O44390 86 0 -
HRLWAHRAYKATLSWRVFLML O45892 88 0 -
HRMWSHRAYRGTDLLRWFMSF O13378 92 0 -
HRLWSHRSYSAHWPLRLFYAI ACO1_YEAST 161 0 -
HRHWAHRAYDCKLPVKIFFAL P79049 101 0 -
HRLVTHRSFQTPKWLEYFLVL Q44502 60 0 -
HRLITHRSFETPKWLEYFLAF O33722 60 0 -

Motif 4 width=30
Element Seqn Id St Int Rpt
HRAHHKFSETHADPHNSRRGFFFSHVGWLL ACOD_RAT 156 16 -
HRAHHKFSETDADPHNSRRGFFFSHVGWLL O62849 157 16 -
HRAHHKFSETHADPHNSRRGFFFSHVGWLL ACOD_HUMAN 157 16 -
HRAHHKFSETHADPHNSRRGFFFSHVGWLL ACO2_MOUSE 156 16 -
HRAHHKFSETHADPHNSRRGFFFSHVGWLL ACO1_MOUSE 153 16 -
HRAHHKFSETYADPHDSRRGFFFSHVGWLL ACOD_MESAU 152 16 -
HRVHHKYSETDADPHNAVRGFFFSHVGWLL Q92038 128 16 -
HRVHHKYSETDADPHNATRGFFFSHVGWLL Q94541 157 16 -
HRMHHKYSETDADPHNATRGFFFSHVGWLL O44428 127 16 -
HRCHHKWTDTDADPHNTTRGFFFAHMGWLL O01708 134 16 -
HRCHHKWTDTDADPHNTTRGFFFTHMGWLL O16918 133 16 -
HRMHHKFSETTADPHDATRGFFFSHVGWLL Q27437 109 16 -
HRLHHKYSDTDADPHNASRGFFYSHVGWLL O44390 123 16 -
HRCHHKWTDTDADPHSTNRGMFFAHMGWLL O45892 125 16 -
HRAHHRWTDTDKDPYSAHRGFFFSHFGWML O13378 129 16 -
HRIHHRYTDTLRDPYDARRGLWYSHMGWML ACO1_YEAST 198 16 -
HRVHHRYTDTPRDPYDAKRGFWYSHMGWML P79049 138 16 -
HRIHHLHSDTDPDPHDSNKGFWWSHIGWLI Q44502 97 16 -
HRMHHLYSDQTLDPHDSNKGFWWSHMGWML O33722 97 16 -

Motif 5 width=19
Element Seqn Id St Int Rpt
YKPGLLLMCFILPTLVPWY ACOD_RAT 217 31 -
YKPGVLLLCFILPTLVPWY O62849 218 31 -
YKPGLLMMCFILPTLVPWY ACOD_HUMAN 218 31 -
YKPDLLLMCFVLPTLVPWY ACO2_MOUSE 217 31 -
YKPGLLLMCFILPTLVPWY ACO1_MOUSE 214 31 -
YKPAILLMCFILPTFVPWY ACOD_MESAU 213 31 -
YKPSVLLMCFFVPTFVPWY Q92038 189 31 -
YMILMPIACFIIPTVVPMY Q94541 218 31 -
YLTLMPLICFILPSYIPTL O44428 188 31 -
YFPLVILCCFILPTIIPVY O01708 195 31 -
YFPLVILFCFILPTIIPVY O16918 194 31 -
YLPLMVTICFIVPALLPWW Q27437 170 31 -
AVPLIGTVCFALPTLIPVY O44390 184 31 -
YLPLVGIFCFALPTFIPVV O45892 186 31 -
YPYFALGMGFIFPTLVAGL O13378 187 28 -
YILLMLLTAFVIPTLICGY ACO1_YEAST 256 28 -
YLLLMVVMAFLFPAVLTHY P79049 196 28 -
YFIFIQIALGLLLLYLGGW Q44502 154 27 -
YFIPIQVALGVVLYLLGGW O33722 154 27 -

Motif 6 width=22
Element Seqn Id St Int Rpt
FLRYTLVLNATWLVNSAAHLYG ACOD_RAT 250 14 -
FLRYAVVLNATWLVNSAAHMYG O62849 251 14 -
FLRYAVVLNATWLVNSAAHLFG ACOD_HUMAN 251 14 -
FLRYAVVLNATWLVNSAAHLYG ACO2_MOUSE 250 14 -
FLRYTLVLNATWLVNSAAHLYG ACO1_MOUSE 247 14 -
FLRYTLVLNATWLVNSAAHLYG ACOD_MESAU 246 14 -
LLRYALVLNATWLVNSAAHMWG Q92038 222 14 -
MFRWCFILNVTWLVNSAAHKFG Q94541 251 14 -
IFRYVYVLNVTWLVNSAAHLWG O44428 220 13 -
TFRYCFTLHATWCINSAAHYFG O01708 228 14 -
TFRYCFTLHATWCINSAAHYFG O16918 227 14 -
LTRYCFTLNMTWLVNSAAHIWG Q27437 203 14 -
LFRYIFNLNVTFLVNSAAHIWG O44390 216 13 -
LFRYCFTLHATWCINSVSHWVG O45892 219 14 -
VLRLCFVHHATFCVNSLAHYLG O13378 219 13 -
FIRVFVIQQATFCINSMAHYIG ACO1_YEAST 288 13 -
LLRAVVIQQATFCVNSLAHWIG P79049 228 13 -
FFRIVWVYHCTWLVNSATHKFG Q44502 180 7 -
FFRIVVVFHCTWFVNSATHKFG O33722 180 7 -

Motif 7 width=15
Element Seqn Id St Int Rpt
GEGFHNYHHAFPYDY ACOD_RAT 293 21 -
GEGFHNYHHTFPYDY O62849 294 21 -
GEGFHNYHHSFPYDY ACOD_HUMAN 294 21 -
GERFHNYHHAFPYDY ACO2_MOUSE 293 21 -
GEGFHNYHHTFPFDY ACO1_MOUSE 290 21 -
GEGFHNYHHAFPYDY ACOD_MESAU 289 21 -
GEGFHNYHHTFPFDY Q92038 265 21 -
GEGWHNYHHVFPWDY Q94541 294 21 -
GEGFHNYHHTFPWDY O44428 263 21 -
GEGGHNFHHTFPQDY O01708 271 21 -
GEGGHNFHHTFPQDY O16918 270 21 -
GEGFHNYHHTFPYDY Q27437 246 21 -
GEGFHNYHHVFPWDY O44390 259 21 -
GEGGHNYHHTFPQDY O45892 262 21 -
GEGYHNFHHQFPQDY O13378 262 21 -
GEGYHNFHHEFPTDY ACO1_YEAST 331 21 -
GEGYHNFHHEFPSDY P79049 271 21 -
GEGWHNNHHAFQYSA Q44502 223 21 -
GEGWHNNHHAFQYSA O33722 223 21 -