SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00073

Identifier
COPRGNOXDASE  [View Relations]  [View Alignment]  
Accession
PR00073
No. of Motifs
7
Creation Date
06-FEB-1995  (UPDATE 07-JUN-1999)
Title
Coprogen oxidase signature
Database References

PROSITE; PS01021 COPROGEN_OXIDASE
PFAM; PF01218 Coprogen_oxidas
INTERPRO; IPR001260
Literature References
1. MADSEN, O., SANDAL, L., SANDAL, N.N. AND MARCKER, K.A.
A soybean coproporphyrinogen oxidase gene is highly expressed in 
root nodules.
PLANT MOL.BIOL. 23 35-43 (1993).
 
2. KOHNO, H., FURUKAWA, T., YOSHINAGA, T., TOKUNAGA, R. AND TAKETANI, S.
Coproporphyrin oxidase. Purification, molecular cloning, and induction of
mRNA during erythroid differentiation.
J.BIOL.CHEM. 268 21359-21363 (1993).
 
3. CAMADRO, J.M., CHAMBON, H., JOLLES, J. AND LABBE, P.
Purification and properties of coproporphyrinogen oxidase from the yeast
Saccharomyces cerevisiae.
EUR.J.BIOCHEMISTRY 156 579-587 (1986).

Documentation
Coprogen oxidase (i.e. coproporphyrin III oxidase or coproporphyrinogenase)
catalyses the oxidative decarboxylation of coproporphyrinogen III to proto-
porhyrinogen IX in the haem and chlorophyll biosynthetic pathways [1,2].
The protein is a homodimer containing 2 iron atoms per molecule of native
protein [3]. The iron atoms can be removed neither by exhaustive dialysis
nor by gel filtration, indicating that they are internally bound [3]: their
involvement in the catalytic activity cannot be demonstrated, the enzyme
only being active in the presence of molecular oxygen (acting as the
electron acceptor) [3]. Thiol-directed agents partially inhibit catalytic
activity, indicating that an SH group is required for activity [3].
 
COPRGNOXDASE is a 7-element fingerprint that provides a signature for
coprogen oxidases. The fingerprint was derived from an initial alignment
of 6 sequences: the motifs were drawn from conserved regions spanning
virtually the full alignment length, motif 5 including the region encoded
by PROSITE pattern COPROGEN_OXIDASE (PS01021), a highly-conserved charged
area containing the putative catalytically-important Cys. Two iterations on
OWL25.1 were required to reach convergence, at which point a true set
comprising 7 sequences was identified.
 
An update on SPTR37_9f identified a true set of 11 sequences, and 1
partial match.
Summary Information
  11 codes involving  7 elements
1 codes involving 6 elements
0 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
711111111111111
61111110
50000000
40000000
30000000
20000000
1234567
True Positives
HEM6_ECOLI    HEM6_HORVU    HEM6_HUMAN    HEM6_MOUSE    
HEM6_PSEAE HEM6_SALTY HEM6_SOYBN HEM6_SYNY3
HEM6_TOBAC HEM6_YEAST Q14060
True Positive Partials
Codes involving 6 elements
O48754
Sequence Titles
HEM6_ECOLI  COPROPORPHYRINOGEN III OXIDASE, AEROBIC (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) - ESCHERICHIA COLI. 
HEM6_HORVU COPROPORPHYRINOGEN III OXIDASE PRECURSOR (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) - HORDEUM VULGARE (BARLEY).
HEM6_HUMAN COPROPORPHYRINOGEN III OXIDASE PRECURSOR (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) (COX) - HOMO SAPIENS (HUMAN).
HEM6_MOUSE COPROPORPHYRINOGEN III OXIDASE PRECURSOR (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) (COX) - MUS MUSCULUS (MOUSE).
HEM6_PSEAE COPROPORPHYRINOGEN III OXIDASE, AEROBIC (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) - PSEUDOMONAS AERUGINOSA.
HEM6_SALTY COPROPORPHYRINOGEN III OXIDASE, AEROBIC (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) - SALMONELLA TYPHIMURIUM.
HEM6_SOYBN COPROPORPHYRINOGEN III OXIDASE PRECURSOR (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) - GLYCINE MAX (SOYBEAN).
HEM6_SYNY3 COPROPORPHYRINOGEN III OXIDASE, AEROBIC (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) - SYNECHOCYSTIS SP. (STRAIN PCC 6803).
HEM6_TOBAC COPROPORPHYRINOGEN III OXIDASE PRECURSOR (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) - NICOTIANA TABACUM (COMMON TOBACCO).
HEM6_YEAST COPROPORPHYRINOGEN III OXIDASE (EC 1.3.3.3) (COPROPORPHYRINOGENASE) (COPROGEN OXIDASE) (COX) - SACCHAROMYCES CEREVISIAE (BAKER'S YEAST).
Q14060 COPROPORPHYRINOGEN OXIDASE - HOMO SAPIENS (HUMAN).

O48754 F21B7.24 - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
Scan History
OWL25_1    2  100  NSINGLE    
SPTR37_9f 2 12 NSINGLE
Initial Motifs
Motif 1  width=17
Element Seqn Id St Int Rpt
AQFKEDVWSRPGGGGGI HEM6_SOYBN 105 105 -
ANFSVDRWERKEGGGGI HEM6_HUMAN 74 74 -
ADFTVDRWERKEGGGGI HEM6_MOUSE 74 74 -
ANFVEDSWRREAGGGGR HEM6_SALTY 29 29 -
AEFVEDSWQREAGGGGR HEM6_ECOLI 29 29 -
VKFHADTWTRGNDGGGG HEM6_YEAST 37 37 -

Motif 2 width=22
Element Seqn Id St Int Rpt
SRVLQDGAVWEKAGVNVSVVYG HEM6_SOYBN 122 0 -
SCVLQDGCVFEKAGVSISVVHG HEM6_HUMAN 91 0 -
TCVLQDGRVFEKAGVSISVVHG HEM6_MOUSE 91 0 -
SRVLRNGGIFEQAGVNFSHVHG HEM6_SALTY 46 0 -
SRVLRNGGVFEQAGVNFSHVHG HEM6_ECOLI 46 0 -
SMVIQDGTTFEKGGVNVSVVYG HEM6_YEAST 55 1 -

Motif 3 width=25
Element Seqn Id St Int Rpt
AAGISSVLHPKNPFAPTLHFNYRYF HEM6_SOYBN 169 25 -
AMGVSSVTHPKNPHAPTIHFNYRYF HEM6_HUMAN 140 27 -
AMGVSSVIHPKNPYAPTMHFNYRYF HEM6_MOUSE 140 27 -
AMGVSLVVHPHNPYIPTSHANVRFF HEM6_SALTY 88 20 -
AMGVSLVVHPHNPYVPTSHANVRFF HEM6_ECOLI 88 20 -
ACGLSMVIHPVNPHAPTTHLNYRYF HEM6_YEAST 113 36 -

Motif 4 width=23
Element Seqn Id St Int Rpt
WWFGGGTDLTPAYIFEEDVKHFH HEM6_SOYBN 208 14 -
WWFGGGCDLTPTYLNQEDAVHFH HEM6_HUMAN 175 10 -
WWFGGGCDLTPRYLNQEDAVHFH HEM6_MOUSE 175 10 -
WWFGGGFDLTPYYGFEEDAVHWH HEM6_SALTY 123 10 -
WWFGGGFDLTPFYGFEEDAIHWH HEM6_ECOLI 123 10 -
WWFGGGADLTPSYLYEEDGQLFH HEM6_YEAST 149 11 -

Motif 5 width=30
Element Seqn Id St Int Rpt
YPRFKKWCDDYFYIKHRGERRGLGGIFFDD HEM6_SOYBN 245 14 -
YPKFKKWCDDYFFIAHRGERRGIGGIFFDD HEM6_HUMAN 212 14 -
YPKFKKWCDDYFFIVHRGERRGIGGIFFDD HEM6_MOUSE 212 14 -
YPRYKKWCDDYFFLKHRNEQRGVGGLFFDD HEM6_SALTY 160 14 -
YPRYKKWCDEYFYLKHRNEQRGIGGLFFDD HEM6_ECOLI 160 14 -
YPRFKKWCDEYFYITHRKETRGIGGIFFDD HEM6_YEAST 186 14 -

Motif 6 width=28
Element Seqn Id St Int Rpt
WQQLRRGRYVEFNLVYDRGTTFGLKTGG HEM6_SOYBN 317 42 -
WQQLRRGRYVEFNLLYDRGTKFGLFTPG HEM6_HUMAN 284 42 -
WQQLRRGRYVEFNLLYDRGTKFGLFTPG HEM6_MOUSE 284 42 -
FQLYRRGRYVEFNLVWDRGTLFGLQTGG HEM6_SALTY 232 42 -
FQLYRRGRYVEFNLVWDRGTLFGLQTGG HEM6_ECOLI 232 42 -
WQAIRRGRYVEFNLIYDRGTQFGLRTPG HEM6_YEAST 258 42 -

Motif 7 width=27
Element Seqn Id St Int Rpt
RIESILVSLPLTARWEYDHKPEEGSEE HEM6_SOYBN 345 0 -
RIESILMSLPLTARWEYMHSPSENSKE HEM6_HUMAN 313 1 -
RIESILMSLPLTARWEYMHSPPENSKE HEM6_MOUSE 313 1 -
RTESILMSMPPLVRWEYDWQPEAGSPE HEM6_SALTY 260 0 -
RTESILMSMPPLVRWEYDYQPKDGSPE HEM6_ECOLI 260 0 -
RVESILMSLPEHASWLYNHHPAPGSRE HEM6_YEAST 287 1 -
Final Motifs
Motif 1  width=17
Element Seqn Id St Int Rpt
AQFKEDVWSRPGGGGGI HEM6_SOYBN 105 105 -
ANFSVDRWERKEGGGGI Q14060 174 174 -
ANFSVDRWERKEGGGGI HEM6_HUMAN 74 74 -
AKFKEDVWSRPGGGGGH HEM6_TOBAC 116 116 -
ADFTVDRWERKEGGGGI HEM6_MOUSE 74 74 -
KRFVEDVWSRPGGVCVH HEM6_HORVU 106 106 -
ANFVEDSWRREAGGGGR HEM6_SALTY 29 29 -
AEFVEDSWQREAGGGGR HEM6_ECOLI 29 29 -
GKFQEDSWQREEGGGGR HEM6_SYNY3 46 46 -
ARFAEDAWERPAGGGGR HEM6_PSEAE 30 30 -
VKFHADTWTRGNDGGGG HEM6_YEAST 37 37 -

Motif 2 width=22
Element Seqn Id St Int Rpt
SRVLQDGAVWEKAGVNVSVVYG HEM6_SOYBN 122 0 -
SCVLQDGCVFEKAGVSISVVHG Q14060 191 0 -
SCVLQDGCVFEKAGVSISVVHG HEM6_HUMAN 91 0 -
SSVLQDGAVFEKAGVNVSVVYG HEM6_TOBAC 133 0 -
TCVLQDGRVFEKAGVSISVVHG HEM6_MOUSE 91 0 -
SRVLQDGNVFEKAGVNVSAVIG HEM6_HORVU 123 0 -
SRVLRNGGIFEQAGVNFSHVHG HEM6_SALTY 46 0 -
SRVLRNGGVFEQAGVNFSHVHG HEM6_ECOLI 46 0 -
SRVLADGDFLEQGGVNFSEVWG HEM6_SYNY3 63 0 -
TRVIGDGALIEKGGVNFSHVFG HEM6_PSEAE 47 0 -
SMVIQDGTTFEKGGVNVSVVYG HEM6_YEAST 55 1 -

Motif 3 width=25
Element Seqn Id St Int Rpt
AAGISSVLHPKNPFAPTLHFNYRYF HEM6_SOYBN 169 25 -
AMGVSSVIHPKNPHAPTIHFNYRYF Q14060 240 27 -
AMGVSSVTHPKNPHAPTIHFNYRYF HEM6_HUMAN 140 27 -
AAGVSSVLHPKNPFAPTLHFNYRYF HEM6_TOBAC 181 26 -
AMGVSSVIHPKNPYAPTMHFNYRYF HEM6_MOUSE 140 27 -
SAGISSVLHPKNPFAPTLHFNYRYF HEM6_HORVU 175 30 -
AMGVSLVVHPHNPYIPTSHANVRFF HEM6_SALTY 88 20 -
AMGVSLVVHPHNPYVPTSHANVRFF HEM6_ECOLI 88 20 -
ATGTSMVLHPKNPYIPTVHLNYRYF HEM6_SYNY3 105 20 -
ALGVSLVIHPENPHVPTSHANVRFF HEM6_PSEAE 89 20 -
ACGLSMVIHPVNPHAPTTHLNYRYF HEM6_YEAST 113 36 -

Motif 4 width=23
Element Seqn Id St Int Rpt
WWFGGGTDLTPAYIFEEDVKHFH HEM6_SOYBN 208 14 -
WWFGGGCDLTPTYLNQEDAVHFH Q14060 275 10 -
WWFGGGCDLTPTYLNQEDAVHFH HEM6_HUMAN 175 10 -
WWFGGGTDFTPAYIFEEDVKHFH HEM6_TOBAC 220 14 -
WWFGGGCDLTPRYLNQEDAVHFH HEM6_MOUSE 175 10 -
WWFGGGTDLTPSYLIEEDVKHFH HEM6_HORVU 214 14 -
WWFGGGFDLTPYYGFEEDAVHWH HEM6_SALTY 123 10 -
WWFGGGFDLTPFYGFEEDAIHWH HEM6_ECOLI 123 10 -
WWFGGGADLTPYYPFAEDAAHFH HEM6_SYNY3 135 5 -
WWFGGGFDLTPYYAHEEDCVHWH HEM6_PSEAE 124 10 -
WWFGGGADLTPSYLYEEDGQLFH HEM6_YEAST 149 11 -

Motif 5 width=30
Element Seqn Id St Int Rpt
YPRFKKWCDDYFYIKHRGERRGLGGIFFDD HEM6_SOYBN 245 14 -
YPKFKKWCDDYFFIAHRGERRGIGGIFFDD Q14060 312 14 -
YPKFKKWCDDYFFIAHRGERRGIGGIFFDD HEM6_HUMAN 212 14 -
YPRFKKWCVDYFYIKHRDERRGLGGIFFDD HEM6_TOBAC 257 14 -
YPKFKKWCDDYFFIVHRGERRGIGGIFFDD HEM6_MOUSE 212 14 -
YPRFKKWCDDYFYIKHRNERRGLGGIFFDD HEM6_HORVU 251 14 -
YPRYKKWCDDYFFLKHRNEQRGVGGLFFDD HEM6_SALTY 160 14 -
YPRYKKWCDEYFYLKHRNEQRGIGGLFFDD HEM6_ECOLI 160 14 -
YPVFKRWCDEYFYLKHRQEMRGIGGIFFDY HEM6_SYNY3 172 14 -
YPRYKEWCDRYFHLKHRNEPRGIGGLFFDD HEM6_PSEAE 161 14 -
YPRFKKWCDEYFYITHRKETRGIGGIFFDD HEM6_YEAST 186 14 -

Motif 6 width=28
Element Seqn Id St Int Rpt
WQQLRRGRYVEFNLVYDRGTTFGLKTGG HEM6_SOYBN 317 42 -
WQQLRRGRYVEFNLLYDRGTKFGLFTPG Q14060 384 42 -
WQQLRRGRYVEFNLLYDRGTKFGLFTPG HEM6_HUMAN 284 42 -
WQQLRRGRYVEFNLVYDRGTTFGLKTGG HEM6_TOBAC 329 42 -
WQQLRRGRYVEFNLLYDRGTKFGLFTPG HEM6_MOUSE 284 42 -
WQQVRRGRYVEFNLVYDRGTTFGLKTGG HEM6_HORVU 323 42 -
FQLYRRGRYVEFNLVWDRGTLFGLQTGG HEM6_SALTY 232 42 -
FQLYRRGRYVEFNLVWDRGTLFGLQTGG HEM6_ECOLI 232 42 -
FQLYRRGRYVEFNLVYDRGTIFGLQTNG HEM6_SYNY3 270 68 -
FQAYRRGRYVEFNLVFDRGTLFGLQSGG HEM6_PSEAE 233 42 -
WQAIRRGRYVEFNLIYDRGTQFGLRTPG HEM6_YEAST 258 42 -

Motif 7 width=27
Element Seqn Id St Int Rpt
RIESILVSLPLTARWEYDHKPEEGSEE HEM6_SOYBN 345 0 -
RIESILMSLPLTARWEYMHSPSENSKE Q14060 413 1 -
RIESILMSLPLTARWEYMHSPSENSKE HEM6_HUMAN 313 1 -
RIESILVSLPLTARWEYDHKPEEGTEE HEM6_TOBAC 357 0 -
RIESILMSLPLTARWEYMHSPPENSKE HEM6_MOUSE 313 1 -
RIESILVSLPLTARWEYDHKPEEGSEE HEM6_HORVU 351 0 -
RTESILMSMPPLVRWEYDWQPEAGSPE HEM6_SALTY 260 0 -
RTESILMSMPPLVRWEYDYQPKDGSPE HEM6_ECOLI 260 0 -
RTESILMSLPPLVRWQYCYSPEAGSPE HEM6_SYNY3 298 0 -
RTESILMSLPPQVRWGYDWKPEPGSEE HEM6_PSEAE 261 0 -
RVESILMSLPEHASWLYNHHPAPGSRE HEM6_YEAST 287 1 -