SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00062

Identifier
RIBOSOMALL20  [View Relations]  [View Alignment]  
Accession
PR00062
No. of Motifs
3
Creation Date
27-OCT-1994  (UPDATE 07-JUN-1999)
Title
Ribosomal protein L20 signature
Database References

PROSITE; PS00937 RIBOSOMAL_L20
PFAM; PF00453 Ribosomal_L20
INTERPRO; IPR001081
Literature References
1. GOLDEN, B.L., RAMAKRISHNAN, V. AND WHITE, S.W.
Ribosomal protein L: structural evidence of gene duplication from a 
primitive RNA binding protein.
EMBO J. 12 4901-4908 (1993).
 
2. RAMAKRISHNAN, V. AND GERCHMAN, S.E.
Cloning, sequencing, and overexpression of genes for ribosomal proteins 
from Bacillus stearothermophilus.
J.BIOL.CHEM. 266 880-885 (1991).

Documentation
Protein synthesis is co-ordinated in all cells by ribosomes, ribonucleo-
protein particles containing more than 50 different proteins and several
large RNAs [1]. Low resolution models show the protein arrangement in both
the large and small ribosomal subunits, but higher resolution structures are
required to reveal the detailed mechanistic functioning of the complex [2].
 
L20 is a protein from the large (50S) subunit; in E.coli it is known to
bind directly to the 23S rRNA, and is required for ribosome assembly, but
does not take part in protein synthesis. It belongs to a family of ribosomal
proteins, including L20 from eubacteria, plant and alga chloroplasts and
cyanelles.
 
RIBOSOMALL20 is a 3-element fingerprint that provides a signature for L20
ribosomal proteins. The fingerprint was derived from an initial alignment
of 6 sequences: the motifs were drawn from virtually the full alignment
length, motif 2 including the central region encoded by PROSITE pattern
RIBOSOMAL_L20 (PS00937). Two iterations on OWL24.0 were required to reach
convergence, at which point a true set comprising 14 sequences was
identified.
 
An update on SPTR37_9f identified a true set of 33 sequences.
Summary Information
33 codes involving  3 elements
0 codes involving 2 elements
Composite Feature Index
3333333
2000
123
True Positives
O21274        O67086        O68846        O84842        
O88058 RK20_ASTLO RK20_CHLRE RK20_CHLVU
RK20_CYAPA RK20_EPIVI RK20_EUGGR RK20_GUITH
RK20_LATCL RK20_MAIZE RK20_MARPO RK20_ODOSI
RK20_ORYSA RK20_PINTH RK20_PORPU RK20_TOBAC
RL20_BACST RL20_BACSU RL20_BORBU RL20_ECOLI
RL20_HAEIN RL20_HELPY RL20_MYCFE RL20_MYCGE
RL20_MYCPN RL20_MYCTU RL20_PSESY RL20_SYNY3
RL20_TREPA
Sequence Titles
O21274      RIBOSOMAL PROTEIN L20 - RECLINOMONAS AMERICANA. 
O67086 50S RIBOSOMAL PROTEIN L20 - AQUIFEX AEOLICUS.
O68846 50S RIBOSOMAL PROTEIN L20 - VIBRIO CHOLERAE.
O84842 L20 RIBOSOMAL PROTEIN - CHLAMYDIA TRACHOMATIS.
O88058 50S RIBOSOMAL PROTEIN L20 - STREPTOMYCES COELICOLOR.
RK20_ASTLO CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - ASTASIA LONGA (EUGLENOPHYCEAN ALGA).
RK20_CHLRE CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - CHLAMYDOMONAS REINHARDTII.
RK20_CHLVU CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - CHLORELLA VULGARIS.
RK20_CYAPA CYANELLE 50S RIBOSOMAL PROTEIN L20 - CYANOPHORA PARADOXA.
RK20_EPIVI CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - EPIFAGUS VIRGINIANA (BEECHDROPS).
RK20_EUGGR CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - EUGLENA GRACILIS.
RK20_GUITH CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - GUILLARDIA THETA (CRYPTOMONAS PHI).
RK20_LATCL CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - LATHRAEA CLANDESTINA.
RK20_MAIZE CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - ZEA MAYS (MAIZE).
RK20_MARPO CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - MARCHANTIA POLYMORPHA (LIVERWORT).
RK20_ODOSI CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - ODONTELLA SINENSIS.
RK20_ORYSA CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - ORYZA SATIVA (RICE).
RK20_PINTH CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - PINUS THUNBERGII (GREEN PINE) (JAPANESE BLACK PINE).
RK20_PORPU CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - PORPHYRA PURPUREA.
RK20_TOBAC CHLOROPLAST 50S RIBOSOMAL PROTEIN L20 - NICOTIANA TABACUM (COMMON TOBACCO).
RL20_BACST 50S RIBOSOMAL PROTEIN L20 - BACILLUS STEAROTHERMOPHILUS.
RL20_BACSU 50S RIBOSOMAL PROTEIN L20 - BACILLUS SUBTILIS.
RL20_BORBU 50S RIBOSOMAL PROTEIN L20 - BORRELIA BURGDORFERI (LYME DISEASE SPIROCHETE).
RL20_ECOLI 50S RIBOSOMAL PROTEIN L20 - ESCHERICHIA COLI.
RL20_HAEIN 50S RIBOSOMAL PROTEIN L20 - HAEMOPHILUS INFLUENZAE.
RL20_HELPY 50S RIBOSOMAL PROTEIN L20 - HELICOBACTER PYLORI (CAMPYLOBACTER PYLORI).
RL20_MYCFE 50S RIBOSOMAL PROTEIN L20 - MYCOPLASMA FERMENTANS.
RL20_MYCGE 50S RIBOSOMAL PROTEIN L20 - MYCOPLASMA GENITALIUM.
RL20_MYCPN 50S RIBOSOMAL PROTEIN L20 - MYCOPLASMA PNEUMONIAE.
RL20_MYCTU 50S RIBOSOMAL PROTEIN L20 - MYCOBACTERIUM TUBERCULOSIS.
RL20_PSESY 50S RIBOSOMAL PROTEIN L20 - PSEUDOMONAS SYRINGAE (PV. SYRINGAE).
RL20_SYNY3 50S RIBOSOMAL PROTEIN L20 - SYNECHOCYSTIS SP. (STRAIN PCC 6803).
RL20_TREPA 50S RIBOSOMAL PROTEIN L20 - TREPONEMA PALLIDUM.
Scan History
OWL24_0    2  100  NSINGLE    
SPTR37_9f 2 34 NSINGLE
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
RRIKKFRLFASSFLNAHSRLTRTITQQKIR RL20_EPIVI 11 11 -
KRRKNILTLTSGFQGTHSKLFRTANQQGMR RL20_MARPO 11 11 -
KKHKKILKLSKGFIGSNSKIFKISNQKIMK RL20_ASTLO 12 12 -
KRRTKIRLFASSFRGAHSRLTRTITQQKIK RL20_SOYBN 3 3 -
ARHKKILKQAKGYYGARSRVYRVAFQAVIK RL20_ECOLI 11 11 -
RRRTKIRLFASSFRGAHSRLTRTITQQKIR RL20_TOBAC 11 11 -

Motif 2 width=30
Element Seqn Id St Int Rpt
ALYFSFSDRKKKKRSNKKIWINRINYFLKN RL20_ASTLO 42 0 -
ALVSAHRDRDRKKRDFRGLWISRINAVIRG RL20_SOYBN 33 0 -
ALVSAHRDRDRKKRDFRRLWITRINAVIRE RL20_TOBAC 41 0 -
ALVSSDRDRNNKKRKFRSLWITRINAVIRE RL20_EPIVI 41 0 -
ALASSHRDRGKRKRNLRRLWITRVNAAARD RL20_MARPO 41 0 -
AGQYAYRDRRQRKRQFRQLWIARINAAARQ RL20_ECOLI 41 0 -

Motif 3 width=27
Element Seqn Id St Int Rpt
SYKNFIYAQYKIQLLINRKILAQIAIL RL20_EPIVI 76 5 -
SYNKLIEYLYKKKILLNRKILAQIAIL RL20_MARPO 74 3 -
NYNKIINKIKLNKICINKKILSEIIIN RL20_ASTLO 78 6 -
IYSNLVYSLYTGQWLLNRKIVAQIAIL RL20_SOYBN 69 6 -
SYSKFINGLKKASVEIDRKILADIAVF RL20_ECOLI 74 3 -
SYSRLIHDLYKRQLLLNRKILAQIAIS RL20_TOBAC 76 5 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
KRRKKILKLAKGFRGSHSKLFRTANQQVMK RL20_SYNY3 12 12 -
KRHKKILKLAKGYYGARSRVFRVAKQAVIK RL20_PSESY 12 12 -
ARHKKILKQAKGYYGARSRVYRVAFQAVIK RL20_ECOLI 11 11 -
KRRKKILKLASGFRGAHSRLFRVANQQVMK RK20_CYAPA 11 11 -
ARHKKVLKAAKGYYGARSRVYRVAFQAVIK RL20_HAEIN 11 11 -
ARHKKVLKQAKGYYGARPRVYRVAFQAVIK O68846 12 12 -
KRAKKILQLAKGYRGAHSRLFRIANQQVMK RK20_ODOSI 12 12 -
KRHKKILKLAKGFRGSHSKLFRIANQQVMK RK20_GUITH 12 12 -
RRRKKVLKLAKGYFGAKHALYRVANQQVMK RL20_BACST 12 12 -
KRRKKVLKLAKGYFGSKHTLYKVANQQVMK RL20_BACSU 12 12 -
RKKKKILKLAKGYRGQRSRSYRRAKEAVMR O67086 10 10 -
KRRAKVFKLAKGFKGAHNSLFRTAKQQVLK RK20_PORPU 12 12 -
ARRKKWLKLAKGYFGHKSIGYKVAKQAVVK RL20_MYCFE 11 11 -
RRRTKIRLFASSFRGAHSRLTRTITQQKIR RK20_TOBAC 11 11 -
KRRKKILAFVSGSRGAHSKLFRTANQRKAR RK20_PINTH 11 11 -
KRRKNILTLTSGFQGTHSKLFRTANQQGMR RK20_MARPO 11 11 -
VRRKKWLKQASGSFGTRHASYKVAKQTVIQ RL20_MYCPN 11 11 -
IRRKKWLKQASGSFGTRKASFKAAKQTVIQ RL20_MYCGE 11 11 -
KRRKQVLNLASGFRGSSSRLFRTAQQQTMK RK20_CHLVU 11 11 -
KKRRAILEQASGYRGQRSRLYRKAKEQVTH O88058 12 12 -
RRRTKMRSFASNFRGAHLRLNRVITQQVRR RK20_MAIZE 11 11 -
RRRTKMRLFASSFRGAHSRLTRTITQQKIR RK20_LATCL 11 11 -
KRHKKILNMSKGFRGAASTLFRTANQQNMK RK20_CHLRE 11 11 -
RRRAKMRSFASNFRGAHLRLNRMITQQVRR RK20_ORYSA 11 11 -
RRHKKVLKLARGFYSGRRKHFRKAKEQLER RL20_HELPY 11 11 -
KKRRSILKASRGYRGQRSRLYRKAKEQQLH RL20_MYCTU 12 12 -
RRRKRILKLAKGFRGRCGTNYKAAKDAVSK RL20_TREPA 12 12 -
ARRKRILKKTKGFWGTKKSNYKKAKDTLXK RL20_BORBU 12 12 -
RRIKKFRLFASSFLNAHSRLTRTITQQKIR RK20_EPIVI 11 11 -
SRRKRVLKQAKGFWGDRKGHFRQSRSSVMR O84842 12 12 -
SRHKKIIKNATGYRGRSKNCFSIAIEKVHK O21274 12 12 -
KKHKKILKLSKGFIGSNSKIFKISNQKIMK RK20_ASTLO 12 12 -
KKRKRKISKMKGWVGGHSKLFRTGNQQLMK RK20_EUGGR 11 11 -

Motif 2 width=30
Element Seqn Id St Int Rpt
ALRNAYRDRRKRKRDFRRLWITRINAAARQ RL20_SYNY3 42 0 -
AGQYAYRDRRQKKRQFRALWIARINAGARV RL20_PSESY 42 0 -
AGQYAYRDRRQRKRQFRQLWIARINAAARQ RL20_ECOLI 41 0 -
ALRYAYNDRNKRKRDFRALWIARINASARL RK20_CYAPA 41 0 -
AGQYAYRDRRQRKRQFRQLWIARINAAARQ RL20_HAEIN 41 0 -
AGQYAYRDRRAKKRQFRQLWIARINAAARQ O68846 42 0 -
ALRYSYVGRKQKKRVFRKLWITRINAASRL RK20_ODOSI 42 0 -
ALRYGYHGRKRRKREFRSLWITRINAAVRI RK20_GUITH 42 0 -
SLMYAYRDRRQRKRDFRKLWIVRINAAARQ RL20_BACST 42 0 -
SGNYAFRDRRQKKRDFRKLWITRINAAARM RL20_BACSU 42 0 -
ALYYQYRDRKLRKREFRRLWIARINAAVRA O67086 40 0 -
ALRYSYVGRKRKKRDFRRLWITRINAAAHS RK20_PORPU 42 0 -
SWTYAFRDRKQIKREFRKLWIARINAATRA RL20_MYCFE 41 0 -
ALVSAHRDRDRKKRDFRRLWITRINAVIRE RK20_TOBAC 41 0 -
ALVSAHRDRGKRKRDLRRLWITRINAAARA RK20_PINTH 41 0 -
ALASSHRDRGKRKRNLRRLWITRVNAAARD RK20_MARPO 41 0 -
AAKYAYRDRRNKKRDFRSLWILRLNAALRE RL20_MYCPN 41 0 -
ASKYAYRDRRQKKREFRSLWILRLNAALRA RL20_MYCGE 41 0 -
ALSYSYRDRQQKKREFCGLWVTRLNAAARL RK20_CHLVU 41 0 -
SLVYNYNDRKKRKGDFRQLWIQRINAAARA O88058 42 0 -
AFVSSHRDRGRQKRDFRRLWITRINAATRV RK20_MAIZE 41 0 -
ALFSAHRDRDKQKINFRRLWIARINAVIRK RK20_LATCL 41 0 -
ALRYSYRNRRQKKRDFRRMWITRVNSAVRR RK20_CHLRE 41 0 -
AFVSSHRDRVRQKRDFRRLWISRINAATRI RK20_ORYSA 41 0 -
SMYYAFRDRKQKKREFRSLWVVRINAACRM RL20_HELPY 41 0 -
SLNYAYRDRRARKGEFRKLWIARINAAARL RL20_MYCTU 42 0 -
ALAHSYVARRDRKGSMRRLWISRINASVRT RL20_TREPA 42 0 -
GMMYATRDRKVRKRDFRRLWISRISAALSD RL20_BORBU 42 0 -
ALVSSDRDRNNKKRKFRSLWITRINAVIRE RK20_EPIVI 41 0 -
AMAFNYMHRKDRKGDFRSLWITRLSVASRI O84842 42 0 -
GLQYAYAHRKVNKRFFRNVWIQRINAACTT O21274 42 0 -
ALYFSFSDRKKKKRSNKKIWINRINYFLKN RK20_ASTLO 42 0 -
ARHYAFYDRKKKKNLNKTLWITRINGGLKY RK20_EUGGR 41 0 -

Motif 3 width=27
Element Seqn Id St Int Rpt
SYSKLTGQLKKANIEINRKMLAQLAVL RL20_SYNY3 75 3 -
SYSRFIAGLKKASIEIDRKVLADLAVN RL20_PSESY 75 3 -
SYSKFINGLKKASVEIDRKILADIAVF RL20_ECOLI 74 3 -
TYSKLMGSLKKLNIILNRKSLSQLAIY RK20_CYAPA 74 3 -
SYSKFINGLKKASVEIDRKILADIAVF RL20_HAEIN 74 3 -
SYSRFINGLKKASIEIDRKILADIAVF O68846 75 3 -
SYSRLIHNFKKSNIELNRKMLSQIAVL RK20_ODOSI 75 3 -
NYSCFINSLKRQHIALNRKMLAQLAVS RK20_GUITH 75 3 -
SYSRLMHGLKLAGVEVNRKIVADLAVN RL20_BACST 75 3 -
SYSRLMHGLKLSGIEVNRKMLADLAVN RL20_BACSU 75 3 -
NYSTFINGLKKAGIELDRKILADMAVR O67086 73 3 -
NYSTFITALKKDNIALNRKMLAQLASN RK20_PORPU 75 3 -
SYSKFINGLKRANVTINRKMLSELAIS RL20_MYCFE 74 3 -
SYSRLIHDLYKRQLLLNRKILAQIAIS RK20_TOBAC 76 5 -
SYNRFIQYLYKRQLLPNRKTLAQIAVL RK20_PINTH 74 3 -
SYNKLIEYLYKKKILLNRKILAQIAIL RK20_MARPO 74 3 -
TYSVFINLLKKHNIEINRKVLSELAIK RL20_MYCPN 74 3 -
TYSVFINELKKAKIVINRKVLSELAIK RL20_MYCGE 74 3 -
NYTNFRHNLKKAGIQLNRKVLSQVALR RK20_CHLVU 74 3 -
TYNRFIQGLKAANVEVDRKILAELAVN O88058 75 3 -
SYSKLIHNLSKKELILNRKMLAQVAVS RK20_MAIZE 76 5 -
SYSKLIHDLYKRQLLLNRKILAQIAIS RK20_LATCL 76 5 -
NYSEFMNYLKTHKIQLNRKVIAQLSIC RK20_CHLRE 74 3 -
NYSKLIHNLYKKELILNRKILAQVAVL RK20_ORYSA 76 5 -
SYSRFMHALKVANIELDRKVLADMAMN RL20_HELPY 74 3 -
TYNRLIQGLKAAGVEVDRKNLADIAIS RL20_MYCTU 75 3 -
SYSRFMNGLLQAGIALNRKVLSNMAIE RL20_TREPA 75 3 -
TYSRFIEGLLKSNIKINRKILSNLAIE RL20_BORBU 75 3 -
SYKNFIYAQYKIQLLINRKILAQIAIL RK20_EPIVI 76 5 -
SYSRLINGLKQAGIHLNRKMLSEMAIH O84842 75 3 -
NYSSFIHNLSLQNIQLNRKILSTLAIT O21274 75 3 -
NYNKIINKIKLNKICINKKILSEIIIN RK20_ASTLO 78 6 -
KYNIFVSFLRKTKTYVNKKLLSEINVR RK20_EUGGR 77 6 -