SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00061

Identifier
RIBOSOMALL19  [View Relations]  [View Alignment]  
Accession
PR00061
No. of Motifs
4
Creation Date
27-OCT-1994  (UPDATE 29-JUL-1999)
Title
Ribosomal protein L19 signature
Database References

PROSITE; PS01015 RIBOSOMAL_L19
PFAM; PF01245 Ribosomal_L19
INTERPRO; IPR001857
Literature References
1. GOLDEN, B.L., RAMAKRISHNAN, V. AND WHITE, S.W.
Ribosomal protein L: structural evidence of gene duplication from a 
primitive RNA binding protein.
EMBO J. 12 4901-4908 (1993).
 
2. RAMAKRISHNAN, V. AND GERCHMAN, S.E.
Cloning, sequencing, and overexpression of genes for ribosomal proteins 
from Bacillus stearothermophilus.
J.BIOL.CHEM. 266 880-885 (1991).
 
3. BROSIUS, J. AND ARFSEN, U.
Primary structure of protein L19 from the large subunit of Escherichia
coli ribosomes.
BIOCHEMISTRY 17 508-516 (1978).

Documentation
Protein synthesis is co-ordinated in all cells by ribosomes, ribonucleo-
protein particles containing more than 50 different proteins and several
large RNAs [1]. Low resolution models show the protein arrangement in both
the large and small ribosomal subunits, but higher resolution structures are
required to reveal the detailed mechanistic functioning of the complex [2].
 
L19 is a protein from the large (50S) subunit; in E.coli it is known
to be located at the 30S-50S subunit interface [3], and may play a role in 
the structure and function of the aminoacyl-tRNA binding site. It belongs
to a family of ribosomal proteins, including L19 from eubacteria and red
alga chloroplasts.
 
RIBOSOMALL19 is a 4-element fingerprint that provides a signature for L19
ribosomal proteins. The fingerprint was derived from an initial alignment
of 5 sequences: the motifs were drawn from virtually the full alignment
length, motifs 4 and 5 spanning the C-terminal region encoded by PROSITE
pattern RIBOSOMAL_L19 (PS01015). A single iteration on OWL24.0 was required
to reach convergence, no further sequences being identified beyond the
starting set.
 
An update on SPTR37_9f identified a true set of 24 sequences, and 3
partial matches.
Summary Information
  24 codes involving  4 elements
0 codes involving 3 elements
3 codes involving 2 elements
Composite Feature Index
424242424
30000
20330
1234
True Positives
O67767        O69883        O84031        RK19_CHLVU    
RK19_CYAPA RK19_GUITH RK19_ODOSI RK19_PORPU
RL19_BACST RL19_BACSU RL19_BORBU RL19_ECOLI
RL19_HAEIN RL19_HELPY RL19_LISMO RL19_MYCGE
RL19_MYCLE RL19_MYCPN RL19_MYCTU RL19_SALTY
RL19_SERMA RL19_STRTR RL19_SYNY3 RL19_TREPA
True Positive Partials
Codes involving 2 elements
O48691 RLX1_HUMAN RM19_RECAM
Sequence Titles
O67767      50S RIBOSOMAL PROTEIN L19 - AQUIFEX AEOLICUS. 
O69883 50S RIBOSOMAL PROTEIN L19 - STREPTOMYCES COELICOLOR, AND STREPTOMYCES LIVIDANS.
O84031 L19 RIBOSOMAL PROTEIN - CHLAMYDIA TRACHOMATIS.
RK19_CHLVU CHLOROPLAST 50S RIBOSOMAL PROTEIN L19 - CHLORELLA VULGARIS.
RK19_CYAPA CYANELLE 50S RIBOSOMAL PROTEIN L19 - CYANOPHORA PARADOXA.
RK19_GUITH CHLOROPLAST 50S RIBOSOMAL PROTEIN L19 - GUILLARDIA THETA (CRYPTOMONAS PHI).
RK19_ODOSI CHLOROPLAST 50S RIBOSOMAL PROTEIN L19 - ODONTELLA SINENSIS.
RK19_PORPU CHLOROPLAST 50S RIBOSOMAL PROTEIN L19 - PORPHYRA PURPUREA.
RL19_BACST 50S RIBOSOMAL PROTEIN L19 - BACILLUS STEAROTHERMOPHILUS.
RL19_BACSU 50S RIBOSOMAL PROTEIN L19 - BACILLUS SUBTILIS.
RL19_BORBU 50S RIBOSOMAL PROTEIN L19 - BORRELIA BURGDORFERI (LYME DISEASE SPIROCHETE).
RL19_ECOLI 50S RIBOSOMAL PROTEIN L19 - ESCHERICHIA COLI.
RL19_HAEIN 50S RIBOSOMAL PROTEIN L19 - HAEMOPHILUS INFLUENZAE.
RL19_HELPY 50S RIBOSOMAL PROTEIN L19 - HELICOBACTER PYLORI (CAMPYLOBACTER PYLORI).
RL19_LISMO 50S RIBOSOMAL PROTEIN L19 - LISTERIA MONOCYTOGENES.
RL19_MYCGE 50S RIBOSOMAL PROTEIN L19 - MYCOPLASMA GENITALIUM.
RL19_MYCLE 50S RIBOSOMAL PROTEIN L19 - MYCOBACTERIUM LEPRAE.
RL19_MYCPN 50S RIBOSOMAL PROTEIN L19 - MYCOPLASMA PNEUMONIAE.
RL19_MYCTU 50S RIBOSOMAL PROTEIN L19 - MYCOBACTERIUM TUBERCULOSIS.
RL19_SALTY 50S RIBOSOMAL PROTEIN L19 - SALMONELLA TYPHIMURIUM.
RL19_SERMA 50S RIBOSOMAL PROTEIN L19 - SERRATIA MARCESCENS.
RL19_STRTR 50S RIBOSOMAL PROTEIN L19 - STREPTOCOCCUS THERMOPHILUS.
RL19_SYNY3 50S RIBOSOMAL PROTEIN L19 - SYNECHOCYSTIS SP. (STRAIN PCC 6803).
RL19_TREPA 50S RIBOSOMAL PROTEIN L19 - TREPONEMA PALLIDUM.

O48691 F3I6.17 PROTEIN - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
RLX1_HUMAN PUTATIVE 60S RIBOSOMAL PROTEIN - HOMO SAPIENS (HUMAN).
RM19_RECAM MITOCHONDRIAL 60S RIBOSOMAL PROTEIN L19 - RECLINOMONAS AMERICANA.
Scan History
OWL24_0    1  100  NSINGLE    
SPTR37_9f 3 50 NSINGLE
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
LIQEITKEQLRTDLPDFRPGDTVRVHVKVV RL19_BACST 4 4 -
IIKQLEQEQMKQDVPSFRPGDTVEVKVWVV RL19_ECOLI 3 3 -
IIKQLEQEQMKQNVPSFRPGDTVEVKVWVV RL19_SALTY 3 3 -
IIKQLEQEQMKQDVPAFRPGDSVEVKVWVV RL19_SERMA 3 3 -
IINSIEAEFLKEDLPTIHVGDTIKVGVKIV RL19_SYNY3 8 8 -

Motif 2 width=30
Element Seqn Id St Int Rpt
EGNRERIQVFEGVVIKRRGAGISETFTVRK RL19_BACST 34 0 -
EGSKKRLQAFEGVVIAIRNRGLHSAFTVRK RL19_ECOLI 33 0 -
EGTKKRLQAFEGVVIAIRNRGLHSAFTVRK RL19_SALTY 33 0 -
EGSKKRLQAFERVVIAIRNRGLHSAFTVRK RL19_SERMA 33 0 -
EGGKERIQPYEGTVIAKRNGGISETITVRK RL19_SYNY3 38 0 -

Motif 3 width=24
Element Seqn Id St Int Rpt
VSYGVGVERTFPVHTPKIAKLEVI RL19_BACST 64 0 -
ISNGEGVERVFQTHSPVVDSISVK RL19_ECOLI 63 0 -
ISNGEGVERVFQTHSPVVDSIAVK RL19_SALTY 63 0 -
ISNGEGVERVFQTHSPVIDSITVK RL19_SERMA 63 0 -
IFQGVGVERVFLLHSPRVASIKVL RL19_SYNY3 68 0 -

Motif 4 width=26
Element Seqn Id St Int Rpt
RRGKVRRAKLYYLRELRGKAARIKEK RL19_BACST 88 0 -
RRGAVRKAKLYYLRERTGKAARIKER RL19_ECOLI 87 0 -
RRGAVRKAKLYYLRERTGKAARIKER RL19_SALTY 87 0 -
RRGAVRKAKLYYLRERTGKAARIKER RL19_SERMA 87 0 -
RRGKVRRAKLYYLRDRVGKATRIKQR RL19_SYNY3 92 0 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
LIQEITKEQLRTDLPDFRPGDTVRVHVKVV RL19_BACST 4 4 -
LIEDITKEQLRTDLPAFRPGDTLRVHVKVV RL19_BACSU 7 7 -
LIDEITKSQLNPDVPNFRPGDTVRVHAKVV RL19_LISMO 4 4 -
IIKQLEQEQMKQDVPSFRPGDTVEVKVWVV RL19_ECOLI 3 3 -
IIKQLEQEQMKQNVPSFRPGDTVEVKVWVV RL19_SALTY 3 3 -
LIQSLTEGQLRTDIPSFRPGDTVRVHAKVV RL19_STRTR 4 4 -
IIKQLEQEQMKQDVPAFRPGDSVEVKVWVV RL19_SERMA 3 3 -
RLDFVDKPSLRDDIPAFNPGDTINVHVKVI RL19_MYCTU 3 3 -
IIKQLEQEQLKQNVPSFRPGDTLEVKVWVV RL19_HAEIN 3 3 -
RLDFVDQASLRDDIPAFSPGDTINVHVKVI RL19_MYCLE 3 3 -
IINSIEAEFLKEDLPTIHVGDTIKVGVKIV RL19_SYNY3 8 8 -
LLDSVDAASLRSDVPAFRPGDTVNVHVRVI O69883 4 4 -
LIQQIENQQRKEPAETFRVGDTVRVHFKIV RL19_TREPA 5 5 -
LRKIEQKYLPKKEYPDFRVGYTVRVYYKIK O67767 6 6 -
LIRKIEAQNKKNEAFVFNVGDTVRVVYKII RL19_BORBU 3 3 -
TIDNLHNVFTKKNIPPIRIGDNVKVGVRII RK19_ODOSI 9 9 -
LVQAIQSGTIKTELPDVRVGDLVRIGVSIQ RK19_CHLVU 7 7 -
LISQIESQYLKDNLPEICVGDTVKVGVLIQ RK19_CYAPA 6 6 -
LIDLVEQKQLKAYVPEFSAGDEVNVAIKLK RL19_MYCPN 9 9 -
LIQLVESNHSNKTLPQLQVGDTVRLGVSIT RK19_GUITH 19 19 -
IQQFEDAQLKDKTMPAFKAGDTLRLGITIK RL19_HELPY 6 6 -
LIDAVEQKQLKEYVPEFGAGDEVNVAIKLR RL19_MYCGE 9 9 -
LIKELQDEQCRTDLADFCVGDTIRVATNIS O84031 4 4 -
LMKSVEQPLMKTELPEIKVGDTIRLGLLVK RK19_PORPU 11 11 -

Motif 2 width=30
Element Seqn Id St Int Rpt
EGNRERIQVFEGVVIKRRGAGISETFTVRK RL19_BACST 34 0 -
EGNRERIQIFEGVVIKRRGGGISETFTVRK RL19_BACSU 37 0 -
EGTRERIQLFEGVVIKRRGAGISETFTVRK RL19_LISMO 34 0 -
EGSKKRLQAFEGVVIAIRNRGLHSAFTVRK RL19_ECOLI 33 0 -
EGTKKRLQAFEGVVIAIRNRGLHSAFTVRK RL19_SALTY 33 0 -
EGTRERIQIFEGVVISRKGQGISEMYTVRK RL19_STRTR 34 0 -
EGSKKRLQAFERVVIAIRNRGLHSAFTVRK RL19_SERMA 33 0 -
EGAKERLQVFKGVVIRRQGGGIRETFTVRK RL19_MYCTU 33 0 -
EGSKRRLQAFEGVVIAIRNRGLHSAFTLRK RL19_HAEIN 33 0 -
EGVKERIQVFKGVVIRRQGGGIRETFTVRK RL19_MYCLE 33 0 -
EGGKERIQPYEGTVIAKRNGGISETITVRK RL19_SYNY3 38 0 -
EGNRSRVQQFKGVVIRRQGAGVRETFTVRK O69883 34 0 -
EGKTERIQAYEGLVLCFKNSGVRRTFTVRK RL19_TREPA 35 0 -
EGDKERIQPFEGVVIRIRGSGAGKTFTVRR O67767 36 0 -
EGSNERLQSFEGIVISFQNKGIGKTFLIRK RL19_BORBU 33 0 -
EGNKERVQFYEGTVIAKKNSSINTTLTVRK RK19_ODOSI 39 0 -
EGNKQRIQPFEGTVISKHQAGANSTVTVRK RK19_CHLVU 37 0 -
SGEKERIQFYEGVVISLSKLKNINGTIRVR RK19_CYAPA 42 6 -
EKEKVRIQNFTGTVLRRRGKGISETFIVRK RL19_MYCPN 39 0 -
EGNKERIQATEGVIISKSNCGINLTITIRR RK19_GUITH 49 0 -
EGEKTRTQYFEGVCIAIRGNGVDKTFCVRK RL19_HELPY 36 0 -
EKEKVRVQNFTGTVLRRRGRGISETFMVRK RL19_MYCGE 39 0 -
EGGKERVQVFQGTVMARKGGGAGETVSLHR O84031 34 0 -
EGSKTREQLCEGVVLSRKKRKSLNTSLTLR RK19_PORPU 41 0 -

Motif 3 width=24
Element Seqn Id St Int Rpt
VSYGVGVERTFPVHTPKIAKLEVI RL19_BACST 64 0 -
ISYGVGVERTFPVHTPKIAKIEVV RL19_BACSU 67 0 -
ISNSVGVERTFPVHTPRIAKLEVI RL19_LISMO 64 0 -
ISNGEGVERVFQTHSPVVDSISVK RL19_ECOLI 63 0 -
ISNGEGVERVFQTHSPVVDSIAVK RL19_SALTY 63 0 -
ISSGIGVERTFPIHTPRVDKIEVV RL19_STRTR 64 0 -
ISNGEGVERVFQTHSPVIDSITVK RL19_SERMA 63 0 -
ESYGVGVERTFPVHSPNIDHIEVV RL19_MYCTU 63 0 -
VSNGVGVERVFQTHSPAVDSIAVK RL19_HAEIN 63 0 -
ESYGVGVERTFPVHSPNIDHIEMV RL19_MYCLE 63 0 -
IFQGVGVERVFLLHSPRVASIKVL RL19_SYNY3 68 0 -
VSFSVGVERTFPVHTPIVEKIELV O69883 64 0 -
NSYGVGVERIFPLHSPRIERVDVV RL19_TREPA 65 0 -
ESFGVGIERTFPYYSPNIEKIEVV O67767 66 0 -
ISSGIGVEKIFPVYSPIIEKVEVL RL19_BORBU 63 0 -
VLQGIGVERIFLIHSPKVDSIEVL RK19_ODOSI 69 0 -
SLQGIGVERVFPLYAPCVANLQVL RK19_CHLVU 67 0 -
ILQGIGIERTFLVHSPLIKSINII RK19_CYAPA 73 1 -
TTDGIPIEKNFQIHNPNISIELKR RL19_MYCPN 69 0 -
VLQGIGIERVYLLHSPKLKSIEIL RK19_GUITH 79 0 -
GANNIGVEKIFPFYSESLASVEVL RL19_HELPY 67 1 -
TTDGIPIEKNFQIHNPNIDIEVKR RL19_MYCGE 69 0 -
VAYGEGMEKSFLLNSPKIVSIEVV O84031 64 0 -
SFQGVGVERVFFLNSPRVTFVKVI RK19_PORPU 72 1 -

Motif 4 width=26
Element Seqn Id St Int Rpt
RRGKVRRAKLYYLRELRGKAARIKEK RL19_BACST 88 0 -
RYGKVRRAKLYYLRELRGKAARIKEI RL19_BACSU 91 0 -
RRGKVRRAKLYYLRNLRGKAARIKEI RL19_LISMO 88 0 -
RRGAVRKAKLYYLRERTGKAARIKER RL19_ECOLI 87 0 -
RRGAVRKAKLYYLRERTGKAARIKER RL19_SALTY 87 0 -
RYGKVRRAKLYYLRALQGKAARIKEI RL19_STRTR 88 0 -
RRGAVRKAKLYYLRERTGKAARIKER RL19_SERMA 87 0 -
TRGDVRRAKLYYLRELRGKKAKIKEK RL19_MYCTU 87 0 -
RKGAVRKAKLYYLRERSGKSARIKER RL19_HAEIN 87 0 -
IRGDVRRAKLYYLRELRGKKAKIKEK RL19_MYCLE 87 0 -
RRGKVRRAKLYYLRDRVGKATRIKQR RL19_SYNY3 92 0 -
TRGDVRRAKLYYLRELRGKAAKIKEK O69883 88 0 -
RAGKVRRAKLYYIREKIGKAARIKAR RL19_TREPA 89 0 -
KIGKVRRAKLYYLRELKGKEAERKIK O67767 90 0 -
RRGKVRRAKLYYMRNRIGKAAMKIKE RL19_BORBU 87 0 -
RSSKVRRSKLYYLRNLKGKASRLKQQ RK19_ODOSI 93 0 -
RRAQVSRAKLYYLRSRTGKATRLKEK RK19_CHLVU 91 0 -
RRSKVRRAKLYYLRTLTGKATRLKQR RK19_CYAPA 97 0 -
RRGKVRRAYISYMRERSGKAAKIKER RL19_MYCPN 92 -1 -
RKSKIRRAKLYYLRTRSGKATRLQQR RK19_GUITH 103 0 -
RVGRVRRAKLYYLRDRRGKAARIKEV RL19_HELPY 91 0 -
RRGKVRRAYISYMRERSGKSAKIKEK RL19_MYCGE 92 -1 -
KRGKVSRARLFYLRGKTGKAAKVKEL O84031 88 0 -
RRAKVRRAKLYYLRDLLGKASRLKQI RK19_PORPU 96 0 -