WORKLIST ENTRIES (1):

CADHERIN View alignment View Structure        Cadherin signature
 Type of fingerprint: COMPOUND with 7  elements
Links:
   PRINTS; PR01818 DESMOGLEIN; PR01819 DESMOCADHERN; PR01820 DESMOCOLLIN
   INTERPRO; IPR002126
   PROSITE; PS00232 CADHERIN
   PFAM; PF00028 cadherin; PF01049 Cadherin_C_term

 Creation date 09-JUN-1993; UPDATE 28-MAY-2001

   1. LIAW, C.W., CANNON, C., POWER, M.D., KIBONEKA, P.K. AND RUBIN, L.L.
   Identification and cloning of 2 species of cadherins in bovine endothelial
   cells.
   EMBO J. 9(9) 2701-2708 (1990).

   2. GINSBERG, D., DESIMONE, D. AND GEIGER, B.
   Expression of a novel cadherin (EP-cadherin) in unfertilized eggs and early
   Xenopus embryos.
   DEVELOPMENT 111(2) 315-325 (1991).

   3. WALSH, F.S., BARTON, C.H., PUTT, W., MOORE, S.E., KELSELL, D., SPURR, N.
   AND GOODFELLOW, P.N.
   N-Cadherin gene maps to human chromosome 18 and is not linked to the 
   E-cadherin gene.
   J.NEUROCHEM. 55(3) 805-812 (1990).

   Cadherins, first discovered in mouse teratocarcinoma cells [1], are 
   structurally and functionally similar molecules [2] that take part in 
   selective calcium-dependent adhesion interactions between cell surfaces
   [3]. There are a number of different isoforms distributed in a tissue-
   specific manner in a wide variety of organisms. Cells containing different 
   cadherins tend to segregate in vitro, while those that contain the same 
   cadherins tend to preferentially aggregate together. This observation is 
   linked to the finding that cadherin expression causes morphological changes
   involving the positional segregation of cells into layers, suggesting they 
   may play an important role in the sorting of different cell types during 
   morphogenesis, histogenesis and regeneration. They may also be involved in 
   the regulation of tight and gap junctions, and in the control of 
   intercellular spacing.
  
   Structurally, cadherins comprise a number of domains: these include a
   signal sequence; a propeptide of around 130 residues; an extracellular 
   domain of around 600 residues; a single transmembrane domain; and a 
   well-conserved C-terminal cytoplasmic domain of about 150 residues. 
   The extracellular domain can be subdivided into 5 parts, 4 of which are 
   repeats of about 110 residues, and the fifth contains 4 conserved
   cysteines. The calcium-binding region of cadherins is thought to be located
   in the extracellular domain.
  
   CADHERIN is a 7-element fingerprint that provides a signature for the 
   cadherins. The fingerprint was derived from an initial alignment of 34
   sequences: the motifs were drawn from the N-terminal half of the alignment -
   motif 1 lies in the first cadherin repeat; motifs 2-4 lie in the second
   repeat; motifs 5 and 6 lie in the third repeat; and motif 7 lies at the
   C-terminus of the fourth repeat. Eight iterations on SPTR39_15f were
   required to reach convergence, at which point a true set comprising 205
   sequences was identified. Numerous partial matches were also found, all of
   which are cadherins or cadherin-related proteins that fail to match one or
   more motifs.

  SUMMARY INFORMATION
    205 codes involving  7 elements
     10 codes involving  6 elements
     10 codes involving  5 elements
      7 codes involving  4 elements
      7 codes involving  3 elements
      7 codes involving  2 elements

   COMPOSITE FINGERPRINT INDEX
  
    7| 205  205  205  205  205  205  205  
    6|   8    9    6   10    8   10    9  
    5|   8    8    6    7    3    9    9  
    4|   5    4    2    5    3    5    4  
    3|   2    3    0    5    2    3    6  
    2|   1    1    1    3    3    2    3  
   --+------------------------------------
     |   1    2    3    4    5    6    7  

True positives..
 Q9Y5H8         O75286         O75277         Q9Y5I0         
 Q9UN74         O75285         O75287         Q9Y5H9         
 O15053         Q9Y5H5         O75282         Q9UN72         
 Q9Y5I3         O75288         O75284         Q9Y5H7         
 O75279         Q9Y5I1         O75281         Q9Y5H6         
 O88689         O75278         Q9UN75         O75283         
 Q9UN73         Q9Y5I2         O75280         Q9Y5D1         
 Q9Y5G7         O88690         Q9Y5D8         Q9Y5H2         
 Q9Y5D9         Q9Y5C9         Q9Y5G4         Q9Y5H0         
 Q9Y5D4         Q9Y5G8         Q9Y5D2         CAD6_RAT       
 Q9Y5H3         Q9Y5E0         CAD6_HUMAN     O60330         
 Q9Y5D7         Q90762         Q9Y5D6         Q9Y5H4         
 O54800         CAD6_MOUSE     Q9Y5E8         Q9Y5E2         
 Q9ULB2         CAD8_MOUSE     Q9Y5E4         Q9Y5G6         
 Q9Y5D0         Q9Y5E6         Q9Y5H1         Q9Y5D5         
 CAD8_HUMAN     Q9UN64         Q9UN71         Q9UN65         
 Q9Y5G2         O15039         Q9Y5G5         Q9Y5E1         
 Q9NRJ8         Q9Y5C5         Q9Y5F9         CADA_CHICK     
 Q9Y5G0         Q9Y5C6         Q9Y5E7         Q9Y5C8         
 Q9Y5G3         Q9Y5F1         Q9Y5E5         Q9Y6N8         
 Q9Y5F2         Q15066         Q9Y5G9         Q9Y5D3         
 Q9Y5E3         Q9Y5E9         Q9UN63         Q9Y5F8         
 CADB_HUMAN     CADB_MOUSE     Q9UN67         O93319         
 Q9Z1B1         Q9Z0M3         Q63418         Q91838         
 O93264         CAD5_HUMAN     CADM_HUMAN     Q9ULB5         
 Q90763         Q9Z1B0         Q9Y5F3         O08963         
 Q9Y5C7         Q9Y5G1         Q9UN66         Q9ULB4         
 CAD2_MOUSE     Q9Z1Y3         Q9Y5F0         CAD2_CHICK     
 CAD2_HUMAN     CAD1_MOUSE     Q9Y5C3         Q9Y5F7         
 Q9WTP5         Q63561         Q63315         CADO_XENLA     
 CAD1_HUMAN     Q15855         Q9Y5C4         Q9UN70         
 O60622         Q9UJ99         CADN_XENLA     Q9R0T4         
 O14917         CAD4_CHICK     O35542         CAD5_MOUSE     
 O13129         Q90275         Q08192         Q24292         
 O35161         O88185         O60247         O60246         
 O60245         CADC_HUMAN     Q9R0M0         Q9UII7         
 Q9Y5F4         Q9Y5I4         Q9NYQ7         Q9NYQ6         
 CAD4_MOUSE     CADF_XENLA     CAD1_XENLA     Q9Y5C2         
 Q9Y5F6         O88278         CAD1_CHICK     O57537         
 P79883         Q9Y5I5         Q9Y5F5         Q9WU10         
 O55134         FAT_DROME      Q91353         CADD_CHICK     
 CADB_XENLA     Q9VEU1         Q9VGG5         Q9NPG4         
 Q9V5N8         Q08174         CAD3_HUMAN     Q9VW71         
 Q9VFH5         Q9VVG0         Q9NRT8         CADD_HUMAN     
 DSC2_MOUSE     FATH_HUMAN     O93508         DSC1_MOUSE     
 Q9WTR5         DSC1_HUMAN     Q19482         CAD3_MOUSE     
 Q9NRT7         Q9P2X5         O15943         YOG7_CAEEL     
 Q9TWY4         O93509         DSC1_BOVIN     O88277         
 Q9WVR2         O95206         DSC2_HUMAN     Q9NYQ8         
 O01912         Q9XWM6         Q12864         Q9NRU2         
 DSG3_HUMAN     Q9R100         CADL_RAT       Q19319         
 Q9VAF5         
Subfamily:  Codes involving 6 elements
 Subfamily True positives..
 CAD5_PIG       CAD4_HUMAN     Q9JKP3         DSC3_BOVIN     
 DSC3_HUMAN     O55122         Q9NXU8         O61230         
 DSG2_HUMAN     O01909         
Subfamily:  Codes involving 5 elements
 Subfamily True positives..
 Q9UII8         O95883         CADF_MOUSE     CADF_HUMAN     
 DSG1_HUMAN     Q28634         O75309         O88338         
 Q24298         Q9TYW6         
Subfamily:  Codes involving 4 elements
 Subfamily True positives..
 Q19194         Q9TS15         DSG1_BOVIN     Q9VGW1         
 Q21035         O62328         P73089         
Subfamily:  Codes involving 3 elements
 Subfamily True positives..
 Q9NL47         O76356         Q9VBV7         Q9XY09         
 Q9NXP8         Q17281         Q9YH35         
Subfamily:  Codes involving 2 elements
 Subfamily True positives..
 Q9VAF6         Q9NX86         O94985         P81137         
 P91261         O94831         O44327         


  PROTEIN TITLES
   Q9Y5H8           PROTOCADHERIN ALPHA 3 - Homo sapiens (Human).
   O75286           KIAA0345-LIKE 11 - Homo sapiens (Human).
   O75277           KIAA0345-LIKE 1 - Homo sapiens (Human).
   Q9Y5I0           PROTOCADHERIN ALPHA 13 - Homo sapiens (Human).
   Q9UN74           PROTOCADHERIN ALPHA 4 - Homo sapiens (Human).
   O75285           KIAA0345-LIKE 10 - Homo sapiens (Human).
   O75287           KIAA0345-LIKE 12 - Homo sapiens (Human).
   Q9Y5H9           PROTOCADHERIN ALPHA 2 - Homo sapiens (Human).
   O15053           KIAA0345 - Homo sapiens (Human).
   Q9Y5H5           PROTOCADHERIN ALPHA 9 - Homo sapiens (Human).
   O75282           KIAA0345-LIKE 7 - Homo sapiens (Human).
   Q9UN72           PROTOCADHERIN ALPHA 7 - Homo sapiens (Human).
   Q9Y5I3           PROTOCADHERIN ALPHA 1 - Homo sapiens (Human).
   O75288           KIAA0345-LIKE 13 - Homo sapiens (Human).
   O75284           KIAA0345-LIKE 9 - Homo sapiens (Human).
   Q9Y5H7           PROTOCADHERIN ALPHA 5 - Homo sapiens (Human).
   O75279           KIAA0345-LIKE 3 - Homo sapiens (Human).
   Q9Y5I1           PROTOCADHERIN ALPHA 11 - Homo sapiens (Human).
   O75281           KIAA0345-LIKE 6 - Homo sapiens (Human).
   Q9Y5H6           PROTOCADHERIN ALPHA 8 - Homo sapiens (Human).
   O88689           CNR1 - Mus musculus (Mouse).
   O75278           KIAA0345-LIKE 2 - Homo sapiens (Human).
   Q9UN75           PROTOCADHERIN ALPHA 12 - Homo sapiens (Human).
   O75283           KIAA0345-LIKE 8 - Homo sapiens (Human).
   Q9UN73           PROTOCADHERIN ALPHA 6 - Homo sapiens (Human).
   Q9Y5I2           PROTOCADHERIN ALPHA 10 - Homo sapiens (Human).
   O75280           KIAA0345-LIKE 4 - Homo sapiens (Human).
   Q9Y5D1           PROTOCADHERIN GAMMA A6 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5G7           PROTOCADHERIN GAMMA A6 - Homo sapiens (Human).
   O88690           CNR2 - Mus musculus (Mouse).
   Q9Y5D8           PROTOCADHERIN GAMMA A11 SHORT FORM PROTEIN - Homo sapiens (H
   Q9Y5H2           PROTOCADHERIN GAMMA A11 - Homo sapiens (Human).
   Q9Y5D9           PROTOCADHERIN GAMMA A11 - Homo sapiens (Human).
   Q9Y5C9           PROTOCADHERIN GAMMA A9 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5G4           PROTOCADHERIN GAMMA A9 - Homo sapiens (Human).
   Q9Y5H0           PROTOCADHERIN GAMMA A3 - Homo sapiens (Human).
   Q9Y5D4           PROTOCADHERIN GAMMA A3 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5G8           PROTOCADHERIN GAMMA A5 - Homo sapiens (Human).
   Q9Y5D2           PROTOCADHERIN GAMMA A5 SHORT FORM PROTEIN - Homo sapiens (Hu
   CAD6_RAT         CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) - Rattus
   Q9Y5H3           PROTOCADHERIN GAMMA A10 - Homo sapiens (Human).
   Q9Y5E0           PROTOCADHERIN GAMMA A10 SHORT FORM PROTEIN - Homo sapiens (H
   CAD6_HUMAN       CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) - Homo s
   O60330           KIAA0588 PROTEIN - Homo sapiens (Human).
   Q9Y5D7           PROTOCADHERIN GAMMA A12 SHORT FORM PROTEIN - Homo sapiens (H
   Q90762           CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) (CADHERI
   Q9Y5D6           PROTOCADHERIN GAMMA A1 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5H4           PROTOCADHERIN GAMMA A1 - Homo sapiens (Human).
   O54800           CADHERIN-8 PRECURSOR - Rattus norvegicus (Rat).
   CAD6_MOUSE       CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) - Mus mu
   Q9Y5E8           PROTOCADHERIN BETA 15 - Homo sapiens (Human).
   Q9Y5E2           PROTOCADHERIN BETA 7 - Homo sapiens (Human).
   Q9ULB2           CADHERIN-8 - Homo sapiens (Human).
   CAD8_MOUSE       CADHERIN-8 PRECURSOR - Mus musculus (Mouse).
   Q9Y5E4           PROTOCADHERIN BETA 5 - Homo sapiens (Human).
   Q9Y5G6           PROTOCADHERIN GAMMA A7 - Homo sapiens (Human).
   Q9Y5D0           PROTOCADHERIN GAMMA A7 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5E6           PROTOCADHERIN BETA 3 - Homo sapiens (Human).
   Q9Y5H1           PROTOCADHERIN GAMMA A2 - Homo sapiens (Human).
   Q9Y5D5           PROTOCADHERIN GAMMA A2 SHORT FORM PROTEIN - Homo sapiens (Hu
   CAD8_HUMAN       CADHERIN-8 PRECURSOR - Homo sapiens (Human).
   Q9UN64           PROTOCADHERIN GAMMA B4 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9UN71           PROTOCADHERIN GAMMA B4 - Homo sapiens (Human).
   Q9UN65           PROTOCADHERIN GAMMA B2 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5G2           PROTOCADHERIN GAMMA B2 - Homo sapiens (Human).
   O15039           KIAA0327 PROTEIN - Homo sapiens (Human).
   Q9Y5G5           PROTOCADHERIN GAMMA A8 - Homo sapiens (Human).
   Q9Y5E1           PROTOCADHERIN BETA 9 - Homo sapiens (Human).
   Q9NRJ8           PROTOCADHERIN 3H - Homo sapiens (Human).
   Q9Y5C5           PROTOCADHERIN GAMMA B6 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5F9           PROTOCADHERIN GAMMA B6 - Homo sapiens (Human).
   CADA_CHICK       CADHERIN-10 PRECURSOR - Gallus gallus (Chicken).
   Q9Y5G0           PROTOCADHERIN GAMMA B5 - Homo sapiens (Human).
   Q9Y5C6           PROTOCADHERIN GAMMA B5 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5E7           PROTOCADHERIN BETA 2 - Homo sapiens (Human).
   Q9Y5C8           PROTOCADHERIN GAMMA B1 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5G3           PROTOCADHERIN GAMMA B1 - Homo sapiens (Human).
   Q9Y5F1           PROTOCADHERIN BETA 12 - Homo sapiens (Human).
   Q9Y5E5           PROTOCADHERIN BETA 4 - Homo sapiens (Human).
   Q9Y6N8           CADHERIN-10 PRECURSOR - Homo sapiens (Human).
   Q9Y5F2           PROTOCADHERIN BETA 11 - Homo sapiens (Human).
   Q15066           OB-CADHERIN-2 - Homo sapiens (Human).
   Q9Y5G9           PROTOCADHERIN GAMMA A4 - Homo sapiens (Human).
   Q9Y5D3           PROTOCADHERIN GAMMA A4 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5E3           PROTOCADHERIN BETA 6 - Homo sapiens (Human).
   Q9Y5E9           PROTOCADHERIN BETA 14 - Homo sapiens (Human).
   Q9UN63           PROTOCADHERIN GAMMA B7 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5F8           PROTOCADHERIN GAMMA B7 - Homo sapiens (Human).
   CADB_HUMAN       CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) (O
   CADB_MOUSE       CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) (O
   Q9UN67           PROTOCADHERIN BETA 10 - Homo sapiens (Human).
   O93319           CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) (O
   Q9Z1B1           OL-PROTOCADHERIN - Mus musculus (Mouse).
   Q9Z0M3           CADHERIN 7 PRECURSOR - Mus musculus (Mouse).
   Q63418           PROTOCADHERIN 3 - Rattus norvegicus (Rat).
   Q91838           F-CADHERIN - Xenopus laevis (African clawed frog).
   O93264           CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) - 
   CAD5_HUMAN       VASCULAR ENDOTHELIAL-CADHERIN PRECURSOR (VE-CADHERIN) (CADHE
   CADM_HUMAN       CADHERIN-18 PRECURSOR (CADHERIN-14) - Homo sapiens (Human).
   Q9ULB5           CADHERIN-7 - Homo sapiens (Human).
   Q90763           CHICKEN CADHERIN-7 - Gallus gallus (Chicken).
   Q9Z1B0           PROTOCADHERIN X - Mus musculus (Mouse).
   Q9Y5F3           PROTOCADHERIN BETA 1 - Homo sapiens (Human).
   O08963           PROTOCADHERIN 4 - Rattus norvegicus (Rat).
   Q9Y5C7           PROTOCADHERIN GAMMA B3 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5G1           PROTOCADHERIN GAMMA B3 - Homo sapiens (Human).
   Q9UN66           PROTOCADHERIN BETA 8 - Homo sapiens (Human).
   Q9ULB4           CADHERIN-9 PRECURSOR - Homo sapiens (Human).
   CAD2_MOUSE       NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Mus musculus (Mouse
   Q9Z1Y3           NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Rattus norvegicus (
   Q9Y5F0           PROTOCADHERIN BETA 13 - Homo sapiens (Human).
   CAD2_CHICK       NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Gallus gallus (Chic
   CAD2_HUMAN       NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Homo sapiens (Human
   CAD1_MOUSE       EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) (ARC
   Q9Y5C3           PROTOCADHERIN GAMMA C4 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5F7           PROTOCADHERIN GAMMA C4 - Homo sapiens (Human).
   Q9WTP5           PB-CADHERIN - Mus musculus (Mouse).
   Q63561           SHORT TYPE PB-CADHERIN - Rattus norvegicus (Rat).
   Q63315           LONG TYPE PB-CADHERIN - Rattus norvegicus (Rat).
   CADO_XENLA       NEURAL-CADHERIN 2 PRECURSOR (N-CADHERIN 2) - Xenopus laevis 
   CAD1_HUMAN       EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) (CAM
   Q15855           UVOMORULIN PRECURSOR (E-CADHERIN) (ARC-1/UVOMORULIN) - Homo 
   Q9Y5C4           PROTOCADHERIN GAMMA C3 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9UN70           PROTOCADHERIN GAMMA C3 - Homo sapiens (Human).
   O60622           PROTOCADHERIN 43 - Homo sapiens (Human).
   Q9UJ99           DJ998H6.1 (ORTHOLOG OF RAT PB-CADHERIN) - Homo sapiens (Huma
   CADN_XENLA       NEURAL-CADHERIN 1 PRECURSOR (N-CADHERIN 1) - Xenopus laevis 
   Q9R0T4           EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) (CAM
   O14917           PROTOCADHERIN 68 - Homo sapiens (Human).
   CAD4_CHICK       RETINAL-CADHERIN PRECURSOR (R-CADHERIN) (R-CAD) - Gallus gal
   O35542           CADHERIN-5 - Mus musculus (Mouse).
   CAD5_MOUSE       VASCULAR ENDOTHELIAL-CADHERIN PRECURSOR (VE-CADHERIN) (CADHE
   O13129           PROTOCADHERIN2 (PCDH2), COMPLETE CDS - Gallus gallus (Chicke
   Q90275           NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Brachydanio rerio (
   Q08192           PROTOCADHERIN 43 PRECURSOR (PC43) (CADHERIN-LIKE PROTEIN) - 
   Q24292           DACHSOUS PROTEIN PRECURSOR (ADHERIN) - Drosophila melanogast
   O35161           SEVEN-PASS TRANSMEMBRANE RECEPTOR PRECURSOR - Mus musculus (
   O88185           BH-PROTOCADHERIN-A - Mus musculus (Mouse).
   O60247           PCDH7 (BH-PCDH)C - Homo sapiens (Human).
   O60246           PCDH7 (BH-PCDH)B - Homo sapiens (Human).
   O60245           PCDH7 (BH-PCDH)A - Homo sapiens (Human).
   CADC_HUMAN       BRAIN-CADHERIN PRECURSOR (BR-CADHERIN) (CADHERIN-12) (N-CADH
   Q9R0M0           FLAMINGO 1 - Mus musculus (Mouse).
   Q9UII7           E-CADHERIN - Homo sapiens (Human).
   Q9Y5F4           PROTOCADHERIN ALPHA C2 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5I4           PROTOCADHERIN ALPHA C2 - Homo sapiens (Human).
   Q9NYQ7           PROTOCADHERIN FLAMINGO 1 - Homo sapiens (Human).
   Q9NYQ6           PROTOCADHERIN FLAMINGO 2 - Homo sapiens (Human).
   CAD4_MOUSE       RETINAL-CADHERIN PRECURSOR (R-CADHERIN) (R-CAD) - Mus muscul
   CADF_XENLA       EP-CADHERIN PRECURSOR (C-CADHERIN) - Xenopus laevis (African
   CAD1_XENLA       EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) - Xe
   Q9Y5C2           PROTOCADHERIN GAMMA C5 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9Y5F6           PROTOCADHERIN GAMMA C5 - Homo sapiens (Human).
   O88278           MEGF2 - Rattus norvegicus (Rat).
   CAD1_CHICK       EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (LIVER CELL ADHES
   O57537           NF-PROTOCADHERIN - Xenopus laevis (African clawed frog).
   P79883           MATERNALLY EXPRESSED NEURAL CADHERIN XMN-CADHERIN - Xenopus.
   Q9Y5I5           PROTOCADHERIN ALPHA C1 - Homo sapiens (Human).
   Q9Y5F5           PROTOCADHERIN ALPHA C1 SHORT FORM PROTEIN - Homo sapiens (Hu
   Q9WU10           PROTOCADHERIN - Rattus norvegicus (Rat).
   O55134           PROTOCADHERIN-4 - Mus musculus (Mouse).
   FAT_DROME        CADHERIN-RELATED TUMOR SUPPRESSOR PRECURSOR (FAT PROTEIN) - 
   Q91353           T-CADHERIN 2 - Gallus gallus (Chicken).
   CADD_CHICK       T-CADHERIN PRECURSOR (TRUNCATED-CADHERIN) (CADHERIN-13) - Ga
   CADB_XENLA       BLASTOMERE-CADHERIN PRECURSOR (B-CADHERIN) - Xenopus laevis 
   Q9VEU1           PUTATIVE CADHERIN PRECURSOR (CG14900 PROTEIN) - Drosophila m
   Q9VGG5           PUTATIVE CADHERIN PRECURSOR - Drosophila melanogaster (Fruit
   Q9NPG4           VASCULAR CADHERIN-2 (PROTOCADHERIN 12) (VASCULAR ENDOTHELIAL
   Q9V5N8           PROTOCADHERIN-LIKE WING POLARITY PROTEIN STAN PRECURSOR (STA
   Q08174           PROTOCADHERIN 1 PRECURSOR (PROTOCADHERIN 42) (PC42) (CADHERI
   CAD3_HUMAN       PLACENTAL-CADHERIN PRECURSOR (P-CADHERIN) - Homo sapiens (Hu
   Q9VW71           PUTATIVE FAT-LIKE CADHERIN PRECURSOR (CG7749 PROTEIN) - Dros
   Q9VFH5           PUTATIVE CADHERIN PRECURSOR (CG3389 PROTEIN) - Drosophila me
   Q9VVG0           PUTATIVE CADHERIN PRECURSOR (CG6445 PROTEIN) - Drosophila me
   Q9NRT8           PROTOCADHERIN ALPHA 6 ALTERNATE ISOFORM - Homo sapiens (Huma
   CADD_HUMAN       T-CADHERIN PRECURSOR (TRUNCATED-CADHERIN) (CADHERIN-13) (H-C
   DSC2_MOUSE       DESMOCOLLIN 2A/2B PRECURSOR (EPITHELIAL TYPE 2 DESMOCOLLIN) 
   FATH_HUMAN       CADHERIN-RELATED TUMOR SUPPRESSOR HOMOLOG PRECURSOR (FAT PRO
   O93508           PARAXIAL PROTOCADHERIN - Brachydanio rerio (Zebrafish) (Zebr
   DSC1_MOUSE       DESMOCOLLIN 1A/1B PRECURSOR - Mus musculus (Mouse).
   Q9WTR5           T-CADHERIN PRECURSOR (TRUNCATED-CADHERIN) (CADHERIN-13) (H-C
   DSC1_HUMAN       DESMOCOLLIN 1A/1B PRECURSOR (DESMOSOMAL GLYCOPROTEIN 2/3) (D
   Q19482           F15B9.7 PROTEIN - Caenorhabditis elegans.
   CAD3_MOUSE       PLACENTAL-CADHERIN PRECURSOR (P-CADHERIN) - Mus musculus (Mo
   Q9NRT7           PROTOCADHERIN ALPHA 1 ALTERNATE ISOFORM - Homo sapiens (Huma
   Q9P2X5           PROTOCADHERIN-XA - Homo sapiens (Human).
   O15943           NEURAL-CADHERIN PRECURSOR (CADHERIN-N PROTEIN) (DN-CADHERIN)
   YOG7_CAEEL       HYPOTHETICAL 375.7 KDA PROTEIN ZK112.7 IN CHROMOSOME III PRE
   Q9TWY4           CADHERIN 3 - Caenorhabditis elegans.
   O93509           PARAXIAL PROTOCADHERIN - Xenopus laevis (African clawed frog
   DSC1_BOVIN       DESMOCOLLIN 1A/1B PRECURSOR (DESMOSOMAL GLYCOPROTEIN 2/3) (D
   O88277           MEGF1 - Rattus norvegicus (Rat).
   Q9WVR2           ARCADLIN - Rattus norvegicus (Rat).
   O95206           PROTOCADHERIN - Homo sapiens (Human).
   DSC2_HUMAN       DESMOCOLLIN 2A/2B PRECURSOR (DESMOSOMAL GLYCOPROTEIN II AND 
   Q9NYQ8           PROTOCADHERIN FAT 2 - Homo sapiens (Human).
   O01912           SIMILARITY TO MULTIPLE CADHERIN-TYPE REPEATS - Caenorhabditi
   Q9XWM6           Y52B11B.2 PROTEIN - Caenorhabditis elegans.
   Q12864           LIVER-INTESTINE-CADHERIN PRECURSOR (LI-CADHERIN) (CADHERIN-1
   Q9NRU2           PROTOCADHERIN ALPHA 10 ALTERNATE ISOFORM - Homo sapiens (Hum
   DSG3_HUMAN       DESMOGLEIN 3 PRECURSOR (130 KDA PEMPHIGUS VULGARIS ANTIGEN) 
   Q9R100           LIVER-INTESTINE-CADHERIN PRECURSOR (LI-CADHERIN) (CADHERIN-1
   CADL_RAT         LIVER-INTESTINE-CADHERIN PRECURSOR (LI-CADHERIN) (CADHERIN-1
   Q19319           HYPOTHETICAL 479.0 KDA PROTEIN F25F2.2 IN CHROMOSOME III - C
   Q9VAF5           PUTATIVE CADHERIN PRECURSOR (CG7805 PROTEIN) - Drosophila me
 
   CAD5_PIG         VASCULAR ENDOTHELIAL-CADHERIN PRECURSOR (VE-CADHERIN) (CADHE
   CAD4_HUMAN       RETINAL-CADHERIN PRECURSOR (R-CADHERIN) (R-CAD) - Homo sapie
   Q9JKP3           PARAXIAL PROTOCADHERIN - Mus musculus (Mouse).
   DSC3_BOVIN       DESMOCOLLIN 3A/3B PRECURSOR - Bos taurus (Bovine).
   DSC3_HUMAN       DESMOCOLLIN 3A/3B PRECURSOR (DESMOCOLLIN 4) (HT-CP) - Homo s
   O55122           DESMOCOLLIN 3 PRECURSOR (MDSC3) (MDSC3A) - Mus musculus (Mou
   Q9NXU8           CDNA FLJ20047 FIS, CLONE COL00577 - Homo sapiens (Human).
   O61230           G-CADHERIN - Lytechinus variegatus (Sea urchin).
   DSG2_HUMAN       DESMOGLEIN 2 PRECURSOR (HDGC) - Homo sapiens (Human).
   O01909           SIMILARITY TO MULTIPLE CADHERIN-TYPE REPEATS - Caenorhabditi
 
   Q9UII8           E-CADHERIN - Homo sapiens (Human).
   O95883           SIMILAR TO PROTOCADHERIN-3 (PCDH3) - Homo sapiens (Human).
   CADF_MOUSE       MUSCLE-CADHERIN PRECURSOR (M-CADHERIN) (CADHERIN-15) (CADHER
   CADF_HUMAN       MUSCLE-CADHERIN PRECURSOR (M-CADHERIN) (CADHERIN-15) (CADHER
   DSG1_HUMAN       DESMOGLEIN 1 PRECURSOR (DESMOSOMAL GLYCOPROTEIN 1) (DG1) (DG
   Q28634           KIDNEY-SPECIFIC CADHERIN PRECURSOR (KSP-CADHERIN) - Oryctola
   O75309           KSP-CADHERIN - Homo sapiens (Human).
   O88338           KSP-CADHERIN - Mus musculus (Mouse).
   Q24298           DE-CADHERIN PRECURSOR (SHOTGUN PROTEIN) - Drosophila melanog
   Q9TYW6           Y66H1B.1 PROTEIN - Caenorhabditis elegans.
 
   Q19194           SIMILAR TO DROSOPHILA CADHERIN-RELATED TUMOR SUPPRESSOR - Ca
   Q9TS15           PEMPHIGUS FOLIACEUS ANTIGEN, DESMOSOMAL CADHERIN, DSG1=DSG1 
   DSG1_BOVIN       DESMOGLEIN 1 PRECURSOR (DESMOSOMAL GLYCOPROTEIN 1) (DG1) (DG
   Q9VGW1           PUTATIVE CADHERIN PRECURSOR (CG4509 PROTEIN) - Drosophila me
   Q21035           SIMILAR TO CADHERIN-TYPE REPEAT. NCBI GI: 1086762 - Caenorha
   O62328           R05H10.6 PROTEIN - Caenorhabditis elegans.
   P73089           FAT PROTEIN - Synechocystis sp. (strain PCC 6803).
 
   Q9NL47           CADHERIN - Ciona intestinalis.
   O76356           C45G7.6 PROTEIN - Caenorhabditis elegans.
   Q9VBV7           PUTATIVE CADHERIN PRECURSOR (CG10421 PROTEIN) - Drosophila m
   Q9XY09           BTR175 PRECURSOR - Bombyx mori (Silk moth).
   Q9NXP8           CDNA FLJ20124 FIS, CLONE COL06056 - Homo sapiens (Human).
   Q17281           CADHERIN HOMOLOG - Botryllus schlosseri.
   Q9YH35           RECEPTOR PROTEIN TYROSINE KINASE - Tetraodon fluviatilis (Pu
 
   Q9VAF6           PUTATIVE CADHERIN PRECURSOR (CG15511 PROTEIN) - Drosophila m
   Q9NX86           CDNA FLJ20377 FIS, CLONE KAIA0462 - Homo sapiens (Human).
   O94985           KIAA0911 PROTEIN - Homo sapiens (Human).
   P81137           INSECTICIDAL TOXIN RECEPTOR BT-R1 PRECURSOR - Manduca sexta 
   P91261           HYPOTHETICAL 35.4 KDA PROTEIN - Caenorhabditis elegans.
   O94831           KIAA0726 PROTEIN - Homo sapiens (Human).
   O44327           HMR-1 - Caenorhabditis elegans.

SCAN HISTORY SPTR39_15f 8 1000 NSINGLE INITIAL MOTIF SETS CADHERIN1 Length of motif = 20 Motif number = 1 Cadherin motif I - 1 PCODE ST INT KVFRVDAETGDVFAIERLDR CAD5_HUMAN 91 91 KIFGVDANTGNVLAYERLDR CAD5_MOUSE 88 88 TIFVIDDKSGNIHATKTLDR CADB_HUMAN 99 99 TLFIIDEKTGDIHATRRIDR CADA_CHICK 100 100 TIFVIDDKSGNIHATKTLDR CADB_MOUSE 99 99 TIFQINDVTGDIHAIKRLDR CAD8_HUMAN 100 100 DLFIINENTGDIQATKRLDR CAD6_HUMAN 99 99 DLFIINENTGDIQATKRLDR CAD6_RAT 99 99 TIFQINDITGDIHAIKRLDR CAD8_MOUSE 107 107 DLFIINEHTGDIQATKRLDR CAD6_MOUSE 99 99 TVFTIDETTGDIHAIRSLDR CADC_HUMAN 100 100 GIFIINPISGQLSVTKPLDR CAD2_CHICK 213 213 EVFSIDPVSGRMYVTRPMDR CAD4_CHICK 215 215 EVFNIDSMSGRMYVTRPMDR CAD4_MOUSE 215 215 GVFIINPIGGQLSVTKPLDR CADN_XENLA 209 209 GIFIINPISGQLSVTKPLDR CAD2_MOUSE 208 208 GVFIINPISGQLSVTKPLDR CADO_XENLA 209 209 GIFIINPISGQLSVTKPLDR CAD2_HUMAN 208 208 GVFAIGREDGWLNVTRPLDR CAD1_XENLA 197 197 GIFIIERETGWLEVTEQLDR CAD1_CHICK 209 209 GVFIIERETGWLKVTEPLDR CAD1_HUMAN 203 203 GVFIIERETGWLKVTQPLDR CAD1_MOUSE 205 205 GVFAVEKETGWLLLNKPLDR CAD3_HUMAN 156 156 GVFRIEWETGWMLVTRPLDR CADF_XENLA 219 219 GVFTIEKESGWLLLHMPLDR CAD3_MOUSE 148 148 GIFRIEKETGWMQVTRPLDR CADB_XENLA 227 227 GIFRINENTGSVSVTRTLDR CADD_HUMAN 186 186 GIFRINEISGDVSVTRPLDR CADD_CHICK 186 186 NLFYIEKDTGDIFCTRSIDR DSC1_HUMAN 183 183 NLFYIEKDTGDIYCTRSIDR DSC1_MOUSE 183 183 NLFYVERDTGNLYCTGRVDR DSC2_MOUSE 184 184 NLFFIEKDTGDIFCTRSIDR DSC1_BOVIN 181 181 NLFYVERDTGNLYCTRPVDR DSC2_HUMAN 184 184 GIFVVDKNTGDINITAIVDR DSG3_HUMAN 98 98 CADHERIN2 Length of motif = 30 Motif number = 2 Cadherin motif II - 1 PCODE ST INT FTHRLFNASVPESSAVGTSVISVTAVDADD CAD5_HUMAN 151 40 FSHQVFNASVPEMSAIGTSVIRVTAVDADD CAD5_MOUSE 148 40 FLHETYHANVPERSNVGTSVIQVTASDADD CADB_HUMAN 159 40 FPEEIYTASVPEMSVVGTSVVQVTATDADD CADA_CHICK 160 40 FLHEIYHANVPERSNVGTSVIQVTASDADD CADB_MOUSE 159 40 FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_HUMAN 160 40 FTKEVYTATVPEMSDVGTFVVQVTATDADD CAD6_HUMAN 159 40 FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_RAT 159 40 FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_MOUSE 167 40 FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_MOUSE 159 40 FLDGPYVATVPEMSPVGAYVLQVKATDADD CADC_HUMAN 160 40 FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_CHICK 272 39 FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_CHICK 274 39 FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_MOUSE 274 39 FLHQIWNGSIPEGSKPGTYVMTVTAIDGDD CADN_XENLA 268 39 FLHQVWNGSVPEGSKPGTYVMTVTAIDADD CAD2_MOUSE 267 39 FLHQIWNGTIPEGSKPGTYVMTVTAIDGDD CADO_XENLA 268 39 FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_HUMAN 267 39 FTQSVFEGSVPEGSKPGTAVMTVSATDADD CAD1_XENLA 256 39 FIKEVFVGYIEENAKPGTSVMTVNATDADD CAD1_CHICK 268 39 FTQEVFKGSVMEGALPGTSVMEVTATDADD CAD1_HUMAN 262 39 FTQEVFEGSVAEGAVPGTSVMKVSATDADD CAD1_MOUSE 264 39 FTQDTFRGSVLEGVLPGTSVMQVTATDEDD CAD3_HUMAN 215 39 FTQDVFRGSVREGVQPGTQVMAVSATDEDD CADF_XENLA 278 39 FTQDTFRGSVLEGVMPGTSVMQVTATDEDD CAD3_MOUSE 207 39 FTQPVFRGSVREGVQPGTKVMSVSATDDDD CADB_XENLA 286 39 FREGPYIGHVMEGSPTGTTVMRMTAFDADD CADD_HUMAN 245 39 FKEGPYVGHVMEGSPTGTTVMRMTAFDADD CADD_CHICK 245 39 FEHRVTIFTVPENCRSGTSVGKVTATDLDE DSC1_HUMAN 242 39 FETKLTVFSVPENCRSGTSVGQVTAIDKDE DSC1_MOUSE 242 39 FTQKLYSFTVQENSRIGSIVGEVCATDLDE DSC2_MOUSE 243 39 FENKLTVFTVPENCRTGTSVGKVTAIDLDE DSC1_BOVIN 240 39 FTEETYTFTIFENCRVGTTVGQVCATDKDE DSC2_HUMAN 243 39 FSQQIFMGEIEENSASNSLVMILNATDADE DSG3_HUMAN 157 39 CADHERIN3 Length of motif = 13 Motif number = 3 Cadherin motif III - 1 PCODE ST INT RYEIVVEARDAQG CAD5_HUMAN 222 41 EYKIVVETQDALG CAD5_MOUSE 219 41 EYHVVIQAKDMGG CADB_HUMAN 231 42 QYQVVIQAKDMGG CADA_CHICK 232 42 EYHVVIQAKDMGG CADB_MOUSE 231 42 EYLVVIQAKDMGG CAD8_HUMAN 232 42 QYQVVIQAKDMGG CAD6_HUMAN 231 42 QYQVVIQAKDMGG CAD6_RAT 231 42 EYLVVIQAIDMGG CAD8_MOUSE 239 42 QYQVVIQAKDMGG CAD6_MOUSE 231 42 QYQVLIQAKDMGG CADC_HUMAN 232 42 QYTLIIQATDMEG CAD2_CHICK 349 47 QYMVIVQATDMEG CAD4_CHICK 351 47 QYTVIVQATDMEG CAD4_MOUSE 351 47 RYTLIIQATDMEG CADN_XENLA 345 47 QYTLIIQATDMEG CAD2_MOUSE 344 47 RYTLIIQATDMEG CADO_XENLA 345 47 QYTLIIQATDMEG CAD2_HUMAN 344 47 VYTLTIQAADGEF CAD1_XENLA 334 48 NYTLIVQATDQEG CAD1_CHICK 346 48 TYTLVVQAADLQG CAD1_HUMAN 340 48 TYTLVVQAADLQG CAD1_MOUSE 342 48 EYTLTIQATDMDG CAD3_HUMAN 293 48 EYTLTVQATDLEG CADF_XENLA 356 48 EYRLTVQATDMDG CAD3_MOUSE 285 48 EYTLTVQAADLDG CADB_XENLA 364 48 KYELIIEAQDMAG CADD_HUMAN 326 51 KYELVIEAKDMGG CADD_CHICK 326 51 TYQLIMEVRDMGG DSC1_HUMAN 317 45 TYKLVMEVRDMGG DSC1_MOUSE 317 45 KYQLLIKVQDMDG DSC2_MOUSE 318 45 TYKLIMEVRDMGG DSC1_BOVIN 315 45 KYQLKIKVQDMDG DSC2_HUMAN 318 45 SYRLVVSGADKDG DSG3_HUMAN 232 45 CADHERIN4 Length of motif = 20 Motif number = 4 Cadherin motif IV - 1 PCODE ST INT GDSGTATVLVTLQDINDNFP CAD5_HUMAN 237 2 GESGTATVMIRLEDINDNFP CAD5_MOUSE 234 2 GLSGTTKVTITLTDVNDNPP CADB_HUMAN 247 3 GLSGTTTVNITLTDVNDNPP CADA_CHICK 248 3 GLSGTTKVTITLTDVNDNPP CADB_MOUSE 247 3 GLSGTTTLTVTLTDVNDNPP CAD8_HUMAN 248 3 GLSGTTTVNITLTDVNDNPP CAD6_HUMAN 247 3 GLSGTTTVNITLTDVNDNPP CAD6_RAT 247 3 GLSGTTTLTVTLTDVNDNPP CAD8_MOUSE 255 3 GLSGTTTVNITLTDVNDNPP CAD6_MOUSE 247 3 GLAGTTIVNITLTDVNDNPP CADC_HUMAN 248 3 GLSNTATAVITVTDVNDNPP CAD2_CHICK 366 4 GLSNTATAIITVTDVNDNPP CAD4_CHICK 368 4 GLSNTATAIITVTDVNDNPP CAD4_MOUSE 368 4 GLSNTATAVIAVTDVNDNPP CADN_XENLA 362 4 GLSNTATAVITVTDVNDNPP CAD2_MOUSE 361 4 GLSNTATAVIAVTDVNDNPP CADO_XENLA 362 4 GLSNTATAVITVTDVNDNPP CAD2_HUMAN 361 4 DRTTTATALIVVMDTNDNPP CAD1_XENLA 349 2 GLSNTATAIIEVTDANDNIP CAD1_CHICK 360 1 GLSTTATAVITVTDTNDNPP CAD1_HUMAN 354 1 GLSTTAKAVITVKDINDNAP CAD1_MOUSE 356 1 GSTTTAVAVVEILDANDNAP CAD3_HUMAN 307 1 GLSVEGKAIIQITDANDNAP CADF_XENLA 370 1 GSTTTAEAVVQILDANDNAP CAD3_MOUSE 299 1 GLTAEGKAVIEITDANDNAP CADB_XENLA 378 1 GLTGTATATIMIDDKNDHSP CADD_HUMAN 342 3 GLTGTATATILIDDKNDHPP CADD_CHICK 342 3 GLFNTGTITISLEDENDNPP DSC1_HUMAN 333 3 GLFTTGTITISLEDENDNSP DSC1_MOUSE 333 3 GLHTTAKCIITIEDVNDNLP DSC2_MOUSE 334 3 GLFNTGTITISLEDENDNAP DSC1_BOVIN 331 3 GLQTTSTCIINIDDVNDHLP DSC2_HUMAN 334 3 GLSTQCECNIKVKDVNDNFP DSG3_HUMAN 246 1 CADHERIN5 Length of motif = 14 Motif number = 5 Cadherin motif V - 1 PCODE ST INT PFFTQTKYTFVVPE CAD5_HUMAN 256 -1 PVFTQSTYTFSVPE CAD5_MOUSE 253 -1 PKFPQRLYQMSVSE CADB_HUMAN 266 -1 PRFPQSTIHLRIPE CADA_CHICK 267 -1 PKFPQSVYQMSVSE CADB_MOUSE 266 -1 PKFAQSLYHFSVPE CAD8_HUMAN 267 -1 PRFPQSTYQFKTPE CAD6_HUMAN 266 -1 PRFPQSTYQFKTPE CAD6_RAT 266 -1 PKFAQSLYHFSVPE CAD8_MOUSE 274 -1 PRFPQSTYQFKTPE CAD6_MOUSE 266 -1 PRFPKSIFHLKVPE CADC_HUMAN 267 -1 PEFTAMTFYGEVPE CAD2_CHICK 385 -1 PEFTTSTYSGEVPE CAD4_CHICK 387 -1 PEFTTSTFAGEVPE CAD4_MOUSE 387 -1 PEFTAMTFYGEVPE CADN_XENLA 381 -1 PEFTAMTFYGEVPE CAD2_MOUSE 380 -1 PEFTAMTFYGEVPE CADO_XENLA 381 -1 PEFTAMTFYGEVPE CAD2_HUMAN 380 -1 PVFDPTQYTAKVPE CAD1_XENLA 368 -1 PIFNPTMYEGVVEE CAD1_CHICK 379 -1 PIFNPTTYKGQVPE CAD1_HUMAN 373 -1 PVFNPSTYQGQVPE CAD1_MOUSE 375 -1 PMFDPQKYEAHVPE CAD3_HUMAN 326 -1 PIFDPKTYTALVPE CADF_XENLA 389 -1 PEFEPQKYEAWVPE CAD3_MOUSE 318 -1 PIFDPKTYTALVPE CADB_XENLA 397 -1 PKFTKKEFQATVEE CADD_HUMAN 361 -1 PEFTKKEFQATVKE CADD_CHICK 361 -1 PSFTETSYVTEVEE DSC1_HUMAN 352 -1 PYFTQTSYTTEVEE DSC1_MOUSE 352 -1 PTFTRTTYVTSVEE DSC2_MOUSE 353 -1 PYFTETSYTVEVEE DSC1_BOVIN 350 -1 PTFTRTSYVTSVEE DSC2_HUMAN 353 -1 PMFRDSQYSARIEE DSG3_HUMAN 265 -1 CADHERIN6 Length of motif = 27 Motif number = 6 Cadherin motif VI - 1 PCODE ST INT NEGIIKPMKPLDYEYIQQYSFIVEATD CAD5_HUMAN 315 45 NEGIIKPTKSLDYEVIQQYTFYIEATD CAD5_MOUSE 312 45 QEGVIKLKKPVDFETERAYSLKVEAAN CADB_HUMAN 325 45 QEGIITVRKPLDYETRRLYTLKVEAEN CADA_CHICK 326 45 QDGVVKLKKPVDFETKRAYSLKIEAAN CADB_MOUSE 325 45 QDGIIRLRKPLDFETKKSYTLKDEAAN CAD8_HUMAN 326 45 QEGIITVKKLLDFEKKKVYTLKVEASN CAD6_HUMAN 325 45 QEGIITVKKLLDFEKKRVYTLKVEASN CAD6_RAT 325 45 QDGVIRLRKPLDFETKKSYTLKVEAAN CAD8_MOUSE 333 45 QEGIITVKKLLDFEKKKVYTLRWKASN CAD6_MOUSE 325 45 QEGVIKLKKPLDFETKKAYTFKVEASN CADC_HUMAN 326 45 NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_CHICK 445 46 NEGMVTVVKAVDYEMNRAFMLTVMVSN CAD4_CHICK 447 46 NEGMVTVVKAVDYELNRAFMLTVMVSN CAD4_MOUSE 447 46 NDGLVTVVKPIDYETKSTYILTVVAEN CADN_XENLA 441 46 NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_MOUSE 440 46 NDGLVTVVKPIDYETKSTYILTVVAEN CADO_XENLA 441 46 NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_HUMAN 440 46 NIGLLKTVKGLDYELKKQYILSVIVTN CAD1_XENLA 427 45 NNGILKTAKGLDYETKSRYDLVVTVEN CAD1_CHICK 439 46 NDGILKTAKGLDFEAKQQYILHVAVTN CAD1_HUMAN 432 45 NDGILKTAKGLDFEAKQQYILHVRVEN CAD1_MOUSE 434 45 NQGILTTRKGLDFEAKNQHTLYVEVTN CAD3_HUMAN 386 46 NQGILTTAKGLDFELRKQYVLQITVEN CADF_XENLA 448 45 NQGVLTTKKGLDFEAQDQHTLYVEVTN CAD3_MOUSE 378 46 NQGILTTAKGLDFEVRKQYVIQITVEN CADB_XENLA 456 45 NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_HUMAN 420 45 NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_CHICK 420 45 NEGVLCVVKPLNYEVNRQVILQVGVIN DSC1_HUMAN 412 46 NEGVLCVVKPLNYEVSRQVTLQIGVLN DSC1_MOUSE 412 46 NEGILCVIKPLDYEERQQVTLQIGVVN DSC2_MOUSE 413 46 NEAVLCVVKPLNYEVNRQVVLQIGVLN DSC1_BOVIN 410 46 NEGVLCVVKPLNYEEKQQMILQIGVVN DSC2_HUMAN 413 46 NEGILKVVKALDYEQLQSVKLSIAVKN DSG3_HUMAN 325 46 CADHERIN7 Length of motif = 18 Motif number = 7 Cadherin motif VII - 1 PCODE ST INT SIVQVHIEVLDENDNAPE CAD5_HUMAN 461 119 SIVQVYIEVLDENDNPPE CAD5_MOUSE 459 120 AQVPVAIRVLDVNDNAPK CADB_HUMAN 470 118 TRVPVYVRILDVNDNAPQ CADA_CHICK 471 118 TKVPVAIRVLDVNDNAPK CADB_MOUSE 470 118 SRVPVAIKVLDVNDNAPE CAD8_HUMAN 471 118 SRVPLYIKVLDVNDNAPE CAD6_HUMAN 470 118 SRVPLYIKVLDVNDNAPE CAD6_RAT 470 118 SRVPVAIKVLDVNDNAPE CAD8_MOUSE 478 118 SRVPLYIKVLDVNDNAPE CAD6_MOUSE 470 118 SKVNILINVLDVNEFPPE CADC_HUMAN 471 118 GTGTLQIYLLDINDNAPQ CAD2_CHICK 593 121 GTGTLQIYLIDINDNAPE CAD4_CHICK 594 120 GTGTLQIYLIDINDNAPQ CAD4_MOUSE 594 120 GTGTLQIYLLDINDNAPY CADN_XENLA 588 120 GTGTLQIYLLDINDNAPQ CAD2_MOUSE 587 120 GTGTLQIYLLDINDNAPY CADO_XENLA 588 120 GTGTLQIYLLDINDNAPQ CAD2_HUMAN 587 120 GTGTLVLNLLDVNDNGPF CAD1_XENLA 571 117 GTGTLLLLLQDVNDNGPT CAD1_CHICK 583 117 GTGTLLLILSDVNDNAPI CAD1_HUMAN 577 118 GTGTLLLVLLDVNDNAPI CAD1_MOUSE 579 118 GTGTLLLTLIDVNDHGPV CAD3_HUMAN 530 117 GTGTLILHVLDVNDNGPV CADF_XENLA 592 117 GTGTLLLTLTDINDHGPI CAD3_MOUSE 522 117 GTGTLILHVLDINDNGPV CADB_XENLA 600 117 GTGTLLITLEDVNDNAPF CADD_HUMAN 567 120 GTGTLHITLEDVNDNVPS CADD_CHICK 567 120 CTGTLVVHLDDYNDHAPQ DSC1_HUMAN 559 120 CTGTLVVLLEDFNDHPPQ DSC1_MOUSE 559 120 CTGTLGIILEDVNDNGPF DSC2_MOUSE 559 119 CTGTLVVFLEDKNDHPPQ DSC1_BOVIN 558 121 CTGTLGIILQDVNDNSPF DSC2_HUMAN 559 119 STGTVYVRVPDFNDNCPT DSG3_HUMAN 477 125 FINAL MOTIF SETS CADHERIN1 Length of motif = 20 Motif number = 1 Cadherin motif I - 8 PCODE ST INT DLLEVNLQNGILFVNSRIDR O75286 73 73 DLLEVNLQNGILFVNSRIDR Q9Y5H8 73 73 DLLEVNLQNGILFVNSRIDR O75277 73 73 DLLEVNLQNGILFVNSRIDR Q9Y5I0 73 73 GLLEVNLQNGILFVNSRIDR O75285 73 73 GLLEVNLQNGILFVNSRIDR Q9UN74 73 73 DLLEVNLQNGILFVNSRIDR O75287 73 73 DLLEVNLQNGILFVNSRIDR Q9Y5H9 73 73 DLLEVNLQNGILFVNSRIDR O15053 73 73 DLLEVNLQNGILFVNSRIDR Q9Y5H5 73 73 DLLEVNLQNGILFVNSRIDR O75282 73 73 DLLEVNLQNGILFVNSRIDR Q9UN72 73 73 DLLEVNLQNGILFVNSRIDR O75288 73 73 DLLEVNLQNGILFVNSRIDR Q9Y5I3 73 73 DLLEVNLQNGILFVNSRIDR O75284 72 72 DLLEVNLQNGILFVNSRIDR Q9Y5H7 72 72 DLLEVNLQNGILFVNSRIDR O75279 73 73 DLLEVNLQNGILFVNSRIDR Q9Y5I1 73 73 DLLEVSLQNGILFVNSRIDR O75281 73 73 DLLEVSLQNGILFVNSRIDR Q9Y5H6 73 73 DLLEVNLQNGILFVNSRIDR O88689 73 73 DLLEVNLQNGILFVNSRIDR O75278 73 73 DLLEVNLQNGILFVNSRIDR Q9UN75 73 73 DLLEVNLQNGILFVNSRIDR O75283 73 73 DLLEVNLQNGILFVNSRIDR Q9UN73 73 73 DLLEVNLQNGILFVNSRIDR O75280 72 72 DLLEVNLQNGILFVNSRIDR Q9Y5I2 72 72 QLFSLNPRNGSLVTAGRIDR Q9Y5D1 73 73 QLFSLNPRNGSLVTAGRIDR Q9Y5G7 73 73 DLLEVNLQNGILFVNSRIDR O88690 73 73 QLFAVNPRSGSLITAGRIDR Q9Y5D8 74 74 QLFAVNPRSGSLITAGRIDR Q9Y5H2 74 74 QLFAVNPRSGSLITAGRIDR Q9Y5D9 74 74 QLFSLNPRSGTLVTAGRIDR Q9Y5C9 73 73 QLFSLNPRSGTLVTAGRIDR Q9Y5G4 73 73 QLFSLNPQSGSLVTAERIDR Q9Y5D4 73 73 QLFSLNPQSGSLVTAERIDR Q9Y5H0 73 73 QLFALNPRSGSLVTAGRIDR Q9Y5D2 73 73 QLFALNPRSGSLVTAGRIDR Q9Y5G8 73 73 DLFIINENTGDIQATKRLDR CAD6_RAT 99 99 QLFSLNPRSGSLITAGRIDR Q9Y5E0 77 77 QLFSLNPRSGSLITAGRIDR Q9Y5H3 77 77 DLFIINENTGDIQATKRLDR CAD6_HUMAN 99 99 QLFALNPRSGSLVTAGRIDR O60330 73 73 QLFALNPRSGSLVTAGRIDR Q9Y5D7 73 73 DLFIINENTGDIQATKRLDR Q90762 99 99 PLFALNPRSGSLITARRIDR Q9Y5D6 73 73 PLFALNPRSGSLITARRIDR Q9Y5H4 73 73 TIFQINDITGDIHAIKRLDR O54800 107 107 DLFIINEHTGDIQATKRLDR CAD6_MOUSE 99 99 QGLQLDLQTGQLILNEKLDR Q9Y5E8 73 73 QILLLSSLTGDLLLNEKLDR Q9Y5E2 73 73 TIFQINDVTGDIHAIKRLDR Q9ULB2 107 107 TIFQINDITGDIHAIKRLDR CAD8_MOUSE 107 107 ELLQLDIKTGNLLLYEKLDR Q9Y5E4 73 73 QLFALNQRSGSLVTAGRIDR Q9Y5D0 73 73 QLFALNQRSGSLVTAGRIDR Q9Y5G6 73 73 QHFQLSHQTGDLLLNEKLDR Q9Y5E6 73 73 QLFALNPRSGSLVTANRIDR Q9Y5D5 73 73 QLFALNPRSGSLVTANRIDR Q9Y5H1 73 73 TIFQINDVTGDIHAIKRLDR CAD8_HUMAN 100 100 PYFTVSAESGELLVSSRLDR Q9UN64 73 73 PYFTVSAESGELLVSSRLDR Q9UN71 73 73 EYFTVNPESGDLLVSDRIDR Q9UN65 73 73 EYFTVNPESGDLLVSDRIDR Q9Y5G2 73 73 QLFALNPRSGSLITAGRIDR O15039 73 73 QLFALNPRSGSLITAGRIDR Q9Y5G5 73 73 QYLLLDSHTGNLLTNEKLDR Q9NRJ8 73 73 QYLLLDSHTGNLLTNEKLDR Q9Y5E1 73 73 LHFSVDAESGDLLVKNRIDR Q9Y5C5 73 73 LHFSVDAESGDLLVKNRIDR Q9Y5F9 73 73 TLFIIDEKTGDIHATRRIDR CADA_CHICK 100 100 PYFTVSAESGELLVSSRLDR Q9Y5C6 73 73 PYFTVSAESGELLVSSRLDR Q9Y5G0 73 73 MHLQFDRQTGDLLLNEKLDR Q9Y5E7 75 75 DYFNVSLESGDLLVNGRIDR Q9Y5C8 70 70 DYFNVSLESGDLLVNGRIDR Q9Y5G3 70 70 ECLQLDTNTGDLLLREMLDR Q9Y5F1 73 73 QRLQLDRQTGDLLLREKLDR Q9Y5E5 72 72 TLFIIDEKTGDIHATRRIDR Q9Y6N8 100 100 QRLQLDINTGDLLLSETLDR Q9Y5F2 73 73 TIFVIDDKSGNIHATKTLDR Q15066 99 99 QLFALNPRSGTLVTAGRIDR Q9Y5D3 73 73 QLFALNPRSGTLVTAGRIDR Q9Y5G9 73 73 QHLQFDPQTHDLLLNEKLDR Q9Y5E3 72 72 KYLHLDLLTGNLLLNEKLDR Q9Y5E9 73 73 LHFSVDAQSGDLLVKDRIDR Q9UN63 73 73 LHFSVDAQSGDLLVKDRIDR Q9Y5F8 73 73 TIFVIDDKSGNIHATKTLDR CADB_HUMAN 99 99 TIFVIDDKSGNIHATKTLDR CADB_MOUSE 99 99 QYLLLDSHTGNLLTNEKLDR Q9UN67 73 73 IIFVIDDKSGNIHATKTLDR O93319 99 99 PYLDLNLETGVLYVNEKIDR Q9Z1B1 62 62 IVFTIDDTTGDIHAIQRLDR Q9Z0M3 105 105 ELLQLDAETGNLFLKEKLDR Q63418 73 73 TMFTIDETTGDIHAIQRLDR Q91838 98 98 TIFVIDDKSGNIHATKTLDR O93264 99 99 KVFRVDAETGDVFAIERLDR CAD5_HUMAN 91 91 TIFIIDDTTGDIHSTKSLDR CADM_HUMAN 99 99 SIFIIDENTGDIHATKRLDR Q90763 93 93 SIFIIDENTGDIHATKRLDR Q9ULB5 93 93 QLFALNPRSGSLVTAGRIDR Q9Z1B0 70 70 MHFRLHRKTGDLFVKEKLDR Q9Y5F3 73 73 QLFSHESAGRNLVTASRIDR O08963 73 73 KFFTVSPENGNLLVSDRIDR Q9Y5C7 73 73 KFFTVSPENGNLLVSDRIDR Q9Y5G1 73 73 LHLQLNQETADLLLNEKLDR Q9UN66 74 74 SLFVIDENTGDIHAAKKLDR Q9ULB4 99 99 GIFIINPISGQLSVTKPLDR CAD2_MOUSE 208 208 GIFIINPISGQLSVTKPLDR Q9Z1Y3 208 208 LHLQLNQETADLLLNEKLDR Q9Y5F0 74 74 GIFIINPISGQLSVTKPLDR CAD2_CHICK 213 213 GIFIINPISGQLSVTKPLDR CAD2_HUMAN 208 208 GVFIIERETGWLKVTQPLDR CAD1_MOUSE 205 205 RHFRVDLDSGALLIKNPIDR Q9Y5C3 73 73 RHFRVDLDSGALLIKNPIDR Q9Y5F7 73 73 TIFLIDELTGDIHATERLDR Q63315 105 105 TIFLIDELTGDIHATERLDR Q63561 105 105 TIFLIDELTGDIHATERLDR Q9WTP5 105 105 GVFIINPISGQLSVTKPLDR CADO_XENLA 209 209 GVFIIERETGWLKVTEPLDR CAD1_HUMAN 203 203 GVFIIERETGWLKVTEPLDR Q15855 199 199 RFFEVNRETGEMFVNDRLDR O60622 75 75 RFFEVNRETGEMFVNDRLDR Q9UN70 75 75 RFFEVNRETGEMFVNDRLDR Q9Y5C4 75 75 TIFLIDELTGDIHAMERLDR Q9UJ99 108 108 GVFIINPIGGQLSVTKPLDR CADN_XENLA 209 209 GVFIIERETGWLKVTQPLDR Q9R0T4 207 207 HLLDVDADSGLLYTKQRIDR O14917 73 73 EVFSIDPVSGRMYVTRPMDR CAD4_CHICK 215 215 KIFGVDANTGNVLAYERLDR CAD5_MOUSE 88 88 KIFGVDANTGNVLAYERLDR O35542 89 89 KYFAVDAASGSLLVSERIDR O13129 76 76 GLFIIDPISGLLSVTKPLDR Q90275 84 84 RFFEVNRETGEMFVNDRLDR Q08192 75 75 TDLAIDRATGEIRTKVKLDR Q24292 68 68 GYFLIDAATGAVTTARSLDR O35161 309 309 RLLRLDETSGWLSVLHRIDR O60245 356 356 RLLRLDETSGWLSVLHRIDR O60246 356 356 RLLRLDETSGWLSVLHRIDR O60247 309 309 RLLRLDETSGWLSVLHRIDR O88185 356 356 TVFTIDETTGDIHAIRSLDR CADC_HUMAN 100 100 HFFSLDPITGVVTTAEELDR Q9R0M0 230 230 GVFIIERETGWLKVTEPLDR Q9UII7 203 203 RYLELDLTSGALFVNERIDR Q9Y5F4 88 88 RYLELDLTSGALFVNERIDR Q9Y5I4 88 88 ELFSIDPQSGLIRTAAALDR Q9NYQ7 374 374 GYFRIDSATGAVSTDSVLDR Q9NYQ6 294 294 EVFNIDSMSGRMYVTRPMDR CAD4_MOUSE 215 215 GVFRIEWETGWMLVTRPLDR CADF_XENLA 219 219 GVFAIGREDGWLNVTRPLDR CAD1_XENLA 197 197 RYFSLSLMSGALAVNQKIDR Q9Y5C2 73 73 RYFSLSLMSGALAVNQKIDR Q9Y5F6 73 73 ELFSIDPQSGLIRTAAALDR O88278 365 365 GIFIIERETGWLEVTEQLDR CAD1_CHICK 209 209 RLLRLDENSGWLSVLHRIDR O57537 328 328 AIFNIDPIFGRMNVTRPLDR P79883 224 224 LYFGVDLPSGNLVVREPADR Q9Y5F5 64 64 LYFGVDLPSGNLVVREPADR Q9Y5I5 64 64 DMFAIHPTSGVVVLTGRLDV Q9WU10 194 194 LPVQMNSEDGLLSTSSRLDR O55134 75 75 REFTLDPVTGEVKTNVVLDR FAT_DROME 101 101 GIFRINEISGDVSVTRPLDR CADD_CHICK 186 186 GIFRINEISGDVSVTRPLDR Q91353 186 186 GIFRIEKETGWMQVTRPLDR CADB_XENLA 227 227 QLFRVNPHNGVMYLQKEIDL Q9VEU1 312 312 DYFLLDAQTGELRTAKPLDR Q9VGG5 281 281 LPIQVDSEEGLLSTGRRLDR Q9NPG4 75 75 SLFKVDSRTGVVTTSASLDR Q9V5N8 405 405 RLLRLDRNTGLITVQGPVDR Q08174 294 294 GVFAVEKETGWLLLNKPLDR CAD3_HUMAN 156 156 SVFRIDPDRGELQIIGYLDR Q9VW71 815 815 DLFDINPHTGIVHTLTKLDR Q9VFH5 324 324 PVFSVDRETGVVRLRQELDR Q9VVG0 66 66 DLLEVNLQNGILFVNSRIDR Q9NRT8 82 82 GIFRINENTGSVSVTRTLDR CADD_HUMAN 186 186 NLFYVERDTGNLYCTGRVDR DSC2_MOUSE 184 184 DMFAIHPTSGVIVLTGRLDY FATH_HUMAN 193 193 SIIDMRQMDGLLTVGEVIDR O93508 63 63 NLFYIEKDTGDIYCTRSIDR DSC1_MOUSE 183 183 GTFRINENTGSVSVTRTLDR Q9WTR5 186 186 NLFYIEKDTGDIFCTRSIDR DSC1_HUMAN 183 183 NLFTLDTMSGEIRLAKSMDR Q19482 211 211 GVFTIEKESGWLLLHMPLDR CAD3_MOUSE 148 148 DLLEVNLQNGILFVNSRIDR Q9NRT7 73 73 RLFHLNATTGLITIKEPLDR Q9P2X5 298 298 GTFNIGPTSGIVKLAKELDF O15943 695 695 SKIKFDEQTLELSVSSPLDR Q9TWY4 64 64 SKIKFDEQTLELSVSSPLDR YOG7_CAEEL 64 64 SLIGVRESDGQLSIMERIDR O93509 67 67 NLFFIEKDTGDIFCTRSIDR DSC1_BOVIN 181 181 TAFKLNARTGLITTTKLVDF O88277 404 404 HLFRLDPRSGRLTLAGQVDY Q9WVR2 295 295 RLFRLDPRSGRLTLAGPVDY O95206 295 295 NLFYVERDTGNLYCTRPVDR DSC2_HUMAN 184 184 VGFKLNARTGLITTTKLMDF Q9NYQ8 404 404 HNFSIDEDTGKIYVTRYLDA O01912 195 195 KWFRIDPSTGIIHLTRLLDF Q9XWM6 218 218 DNIFVIEREGLLYYNRALDR Q12864 67 67 DLLEVNLQNGILFVNSRIDR Q9NRU2 72 72 GIFVVDKNTGDINITAIVDR DSG3_HUMAN 98 98 DGIFKIEKDGLLYHTRALDR Q9R100 66 66 DGIFKIEKDGLLYHTRVLDR CADL_RAT 66 66 SVISIDAKTGIVKLLKSLDR Q19319 782 782 DYFQIDESTGVLKQTKAVDT Q9VAF5 184 184 CADHERIN2 Length of motif = 30 Motif number = 2 Cadherin motif II - 8 PCODE ST INT FERTIYKVRLLENAPNGTLVVTVNATDLDE O75286 242 149 FERTIYKVRLLENAPNGTLVVTVNATDLDE Q9Y5H8 242 149 FYQSVYKVTVLENAFNGTLVIKLNATDPDD O75277 242 149 FYQSVYKVTVLENAFNGTLVIKLNATDPDD Q9Y5I0 242 149 FDRTIYKVRLLENVPNGTLVIKLNASDLDE O75285 242 149 FDRTIYKVRLLENVPNGTLVIKLNASDLDE Q9UN74 242 149 FAQSVYKVKLLENTANGTLVVKLNASDADE O75287 242 149 FAQSVYKVKLLENTANGTLVVKLNASDADE Q9Y5H9 242 149 FDRTLYTVKLPENVSIGTLVIHPNASDLDE O15053 242 149 FDRTLYTVKLPENVSIGTLVIHPNASDLDE Q9Y5H5 242 149 FDRTLYTVKLPENVSIGTLVIHPNASDLDE O75282 242 149 FDRTLYTVKLPENVSIGTLVIHPNASDLDE Q9UN72 242 149 FDQAVYRVHLLETTANGTLVTTLNASDADE O75288 242 149 FDQAVYRVHLLETTANGTLVTTLNASDADE Q9Y5I3 242 149 FDKSIYNVRLLENAPSGTLVIKLNASDADE O75284 241 149 FDKSIYNVRLLENAPSGTLVIKLNASDADE Q9Y5H7 241 149 FDKSEYKVSLMENAAKETLVLKLNATDRDE O75279 242 149 FDKSEYKVSLMENAAKETLVLKLNATDRDE Q9Y5I1 242 149 FEQSEYEVRIFENADNGTTVIKLNASDPDE O75281 242 149 FEQSEYEVRIFENADNGTTVIKLNASDPDE Q9Y5H6 242 149 FDRSLYTVKLPENVPNGTLVVKVNASDLDE O88689 242 149 FDKPSYKVVLSENVQNDTRVIQLNASDPDE O75278 242 149 FDKPSYKVVLSENVQNDTRVIQLNASDPDE Q9UN75 242 149 FEQSEYEVRIFENADNGTTVIRLNASDRDE O75283 242 149 FEQSEYEVRIFENADNGTTVIRLNASDRDE Q9UN73 242 149 FDRPVYEVKMYENQVNQTLVIRLNASDSDE O75280 241 149 FDRPVYEVKMYENQVNQTLVIRLNASDSDE Q9Y5I2 241 149 FTQPVYRVSVPENLPVGTPVLAVTATDQDE Q9Y5D1 242 149 FTQPVYRVSVPENLPVGTPVLAVTATDQDE Q9Y5G7 242 149 FQHPEYEVRILENSDNGTTVIRLNASDKDE O88690 242 149 FTQSVYRVSVPENISSGTRVLMVNATDPDE Q9Y5D8 243 149 FTQSVYRVSVPENISSGTRVLMVNATDPDE Q9Y5H2 243 149 FTQSVYRVSVPENISSGTRVLMVNATDPDE Q9Y5D9 243 149 FAQRIYRVKVLENVPPGTWLLTATASDLDE Q9Y5C9 242 149 FAQRIYRVKVLENVPPGTWLLTATASDLDE Q9Y5G4 242 149 FTQPEYRVSVWENVPVGTRLLTVNATDPDE Q9Y5D4 242 149 FTQPEYRVSVWENVPVGTRLLTVNATDPDE Q9Y5H0 242 149 FTPSEYSVSVPENIPVGTRLLMLTATDPDE Q9Y5D2 242 149 FTPSEYSVSVPENIPVGTRLLMLTATDPDE Q9Y5G8 242 149 FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_RAT 159 40 FTLPEYRVSVPENLPVGTQLLTVTATDRDE Q9Y5E0 246 149 FTLPEYRVSVPENLPVGTQLLTVTATDRDE Q9Y5H3 246 149 FTKEVYTATVPEMSDVGTFVVQVTATDADD CAD6_HUMAN 159 40 FAQPEYRASVPENLALGTQLLVVNATDPDE O60330 242 149 FAQPEYRASVPENLALGTQLLVVNATDPDE Q9Y5D7 242 149 FTKDVYNASIPEMSDVGTFVVQVTATDADD Q90762 159 40 FTQAQYHINVPENVPLGTQLLMVNATDPDE Q9Y5D6 242 149 FTQAQYHINVPENVPLGTQLLMVNATDPDE Q9Y5H4 242 149 FLNGPYHATVPEMSILGTSVTNVTATDADD O54800 167 40 FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_MOUSE 159 40 FVQALYEVQVPENSPVGSLVVKVSARDLDT Q9Y5E8 242 149 FVRSLYKVQVPENSPVGSMVVSVSARDLDT Q9Y5E2 242 149 FLNGPYHATVPEMSILGTSVTNVTATDADD Q9ULB2 167 40 FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_MOUSE 167 40 FLQSFYEVQVPENSPLNSLVVVVSARDLDA Q9Y5E4 242 149 FSLPQYQVTVPENVPVGTRLLTVHAIDLDE Q9Y5D0 242 149 FSLPQYQVTVPENVPVGTRLLTVHAIDLDE Q9Y5G6 242 149 FAQPLYEVAVLENTPVNSVIVTVSASDLDT Q9Y5E6 242 149 FTQPEYRISIPENTLVGTRILTVTATDADE Q9Y5D5 242 149 FTQPEYRISIPENTLVGTRILTVTATDADE Q9Y5H1 242 149 FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_HUMAN 160 40 FSQDVYRVSLSENVYPGTTVLQVTATDQDE Q9UN64 242 149 FSQDVYRVSLSENVYPGTTVLQVTATDQDE Q9UN71 242 149 FSQDVYRVTLREDVPPGFFVLQVTATDRDE Q9UN65 242 149 FSQDVYRVTLREDVPPGFFVLQVTATDRDE Q9Y5G2 242 149 FPHPIYRVKVLENMPPGTRLLTVTASDPDE O15039 242 149 FPHPIYRVKVLENMPPGTRLLTVTASDPDE Q9Y5G5 242 149 FAQALYETQAPENSPVGSLIVKVSAGDADS Q9NRJ8 242 149 FAQALYETQAPENSPVGSLIVKVSAGDADS Q9Y5E1 242 149 FSRDEYRISLSENLPPGSPVLQVTATDQDE Q9Y5C5 242 149 FSRDEYRISLSENLPPGSPVLQVTATDQDE Q9Y5F9 242 149 FPEEIYTASVPEMSVVGTSVVQVTATDADD CADA_CHICK 160 40 FNRDVYRVSLRENVPPGTTVLQVSATDQDE Q9Y5C6 242 149 FNRDVYRVSLRENVPPGTTVLQVSATDQDE Q9Y5G0 242 149 FAKLLYEVQIPEDSPVGSQVAIVSARDLDI Q9Y5E7 244 149 FSQEVYRVSLQENVPWGTSVLRVMATDQDE Q9Y5C8 239 149 FSQEVYRVSLQENVPWGTSVLRVMATDQDE Q9Y5G3 239 149 FEQAFYEVKILENSILGSLVVTVSAWDLDS Q9Y5F1 242 149 FVHTPYGVQVLENSPLDSPIVRVLARDIDA Q9Y5E5 241 149 FPEEIYTASVPEMSVVGTSVVQVTATDADD Q9Y6N8 160 40 FEQAFYEVKIRENSILGSLILIVSAWDLDS Q9Y5F2 242 149 FLHETYHANVPERSNVGTSVIQVTASDADD Q15066 159 40 FTQPEYHVSVRENVPVGTRLLTVKATDPDE Q9Y5D3 242 149 FTQPEYHVSVRENVPVGTRLLTVKATDPDE Q9Y5G9 242 149 FAQELYEAQVPENNPLGSLVITVSARDLDA Q9Y5E3 241 149 FPQSLYEVQVPEDRPLGSWIATISAKDLDA Q9Y5E9 242 149 FSQDVYRVSLREDVPPGTSILRVKATDQDE Q9UN63 242 149 FSQDVYRVSLREDVPPGTSILRVKATDQDE Q9Y5F8 242 149 FLHETYHANVPERSNVGTSVIQVTASDADD CADB_HUMAN 159 40 FLHEIYHANVPERSNVGTSVIQVTASDADD CADB_MOUSE 159 40 FAQALYETQAPENSPIGFLIVKVWAEDVDS Q9UN67 242 149 FLHENYHANVPERSNVGTSVIQVTASDADD O93319 159 40 FDQPVYTVSLPENSPPGTLVIQLNATDPDE Q9Z1B1 250 168 FLDGPYIATVPEMSPVGTSVIQVTATDADD Q9Z0M3 165 40 FVQSLYKVQVPENNPLNAFVVTVSATDLDA Q63418 242 149 FLDGPYTASVPEMSPVGTSIIQVSATDADD Q91838 158 40 FLHENYHANVPEMSNVGTSVIQVTASDADD O93264 159 40 FTHRLFNASVPESSAVGTSVISVTAVDADD CAD5_HUMAN 151 40 FTDGPYIVTVPEMSDMGTSVLQVTATDADD CADM_HUMAN 159 40 FLDGPYTAGVPEMSPVGTSVVQVTATDADD Q90763 153 40 FLDGPYTAGVPEMSPVGTSVVQVTATDADD Q9ULB5 153 40 FRESELEIKMSENAAAGMRFPLPHAWDPDI Q9Z1B0 130 40 FSRLVYRAQVSENSPNGSLVATVTAVDLDE Q9Y5F3 242 149 FDQPVYRVKVLENVTPGTLLLTVRASDPDE O08963 239 146 FTQDMYRVNVAENLPAGSSVLKVMAIDMDE Q9Y5C7 242 149 FTQDMYRVNVAENLPAGSSVLKVMAIDMDE Q9Y5G1 242 149 FQQPFYRVQISEDSPISFLVVKVSATDVDT Q9UN66 243 149 FTKDLYTASVPEMSGVGTSVIQVTATDADD Q9ULB4 159 40 FLHQVWNGSVPEGSKPGTYVMTVTAIDADD CAD2_MOUSE 267 39 FLHQVWNGSVPEGSKPGTYVMTVTAIDADD Q9Z1Y3 267 39 FEQPFYRVQISEDSPVGFLVVKVSATDVDT Q9Y5F0 243 149 FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_CHICK 272 39 FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_HUMAN 267 39 FTQEVFEGSVAEGAVPGTSVMKVSATDADD CAD1_MOUSE 264 39 FQQSSYRISVLESAPAGMVLIQLNASDPDL Q9Y5C3 242 149 FQQSSYRISVLESAPAGMVLIQLNASDPDL Q9Y5F7 242 149 FLHGPYIGSVAELSPTGTSVMQVMASDADD Q63315 165 40 FLHGPYIGSVAELSPTGTSVMQVMASDADD Q63561 165 40 FLHGPYIGSVAELSPTGTSVMQVMASDADD Q9WTP5 165 40 FLHQIWNGTIPEGSKPGTYVMTVTAIDGDD CADO_XENLA 268 39 FTQEVFKGSVMEGALPGTSVMEVTATDADD CAD1_HUMAN 262 39 FTQEVFKGSVMEGALPGTSVMEVTATDADD Q15855 258 39 FNQSLYRARVLEDAPSGTRVVQVLATDLDE O60622 244 149 FNQSLYRARVLEDAPSGTRVVQVLATDLDE Q9UN70 244 149 FNQSLYRARVLEDAPSGTRVVQVLATDLDE Q9Y5C4 244 149 FLHGPYIGSVAELSPTGTSVMQVMASDADD Q9UJ99 168 40 FLHQIWNGSIPEGSKPGTYVMTVTAIDGDD CADN_XENLA 268 39 FIQEVFEGSVAEGALPGTSVMQVSATDADD Q9R0T4 266 39 FEAPSYLVELPENTPLGTVVIDLNATDADE O14917 243 150 FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_CHICK 274 39 FSHQVFNASVPEMSAIGTSVIRVTAVDADD CAD5_MOUSE 148 40 FSHQVFNASVPEMSAIGTSVIRVTAVDADD O35542 149 40 FNQSTYKASVRENTPSGTLVTKVSAYDLDD O13129 244 148 FTHQIWNGTVDEGAKPGTFVMTVTSQDKDD Q90275 143 39 FNQSLYRARVPGGCTSGTRVVQVLATDLDE Q08192 244 149 FNQSRYFATVPENATVGTSVLQVYASDTDA Q24292 233 145 FEQSEYRERIRENLEVGYEVLTIRATDGDA O35161 368 39 FGQSVVEVYFPENNIPGERVATVLATDADS O60245 535 159 FGQSVVEVYFPENNIPGERVATVLATDADS O60246 535 159 FGQSVVEVYFPENNIPGERVATVLATDADS O60247 488 159 FGQSVVEVYFPENNIPGERVATVLATDADS O88185 535 159 FLDGPYVATVPEMSPVGAYVLQVKATDADD CADC_HUMAN 160 40 FEQQEYKESLRENLEVGYEVLTVRATDGDA Q9R0M0 289 39 FTQEVFKGSVMEGALPGTSVMEVTATDADD Q9UII7 262 39 FDQSTYRVQLREDSPPGTLVVKLNASDPDE Q9Y5F4 257 149 FDQSTYRVQLREDSPPGTLVVKLNASDPDE Q9Y5I4 257 149 FEQAQYRETLRENVEEGYPILQLRATDGDA Q9NYQ7 433 39 FEQSEYRERVRENLEVGYEVLTIRASDRDS Q9NYQ6 353 39 FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_MOUSE 274 39 FTQDVFRGSVREGVQPGTQVMAVSATDEDD CADF_XENLA 278 39 FTQSVFEGSVPEGSKPGTAVMTVSATDADD CAD1_XENLA 256 39 FQSSVLRVGIPENAPIGTLLLRLNATDPDE Q9Y5C2 242 149 FQSSVLRVGIPENAPIGTLLLRLNATDPDE Q9Y5F6 242 149 FEQAQYRETLRENVEEGYPILQLRATDGDA O88278 424 39 FIKEVFVGYIEENAKPGTSVMTVNATDADD CAD1_CHICK 268 39 FSQAAVEVAFPENNVLGERVATVLATDADS O57537 507 159 FSSPIFNGSVDEASKPGTYVMTVTAHDADD P79883 283 39 FERSVYRTKVPETAPNGTVLFRVQALDPDE Q9Y5F5 233 149 FERSVYRTKVPETAPNGTVLFRVQALDPDE Q9Y5I5 233 149 FTQTSYKASFDENAPVGTPVMRVSAVDPDE Q9WU10 464 250 FAESSLALEIPEDTVPGTLLINLTATDPDQ O55134 244 149 FDHSDYNVSLNETALPGTPVVTVMASDNDL FAT_DROME 270 149 FKEGPYVGHVMEGSPTGTTVMRMTAFDADD CADD_CHICK 245 39 FKEGPYVGHVMEGSPTGTTVMRMTAFDADD Q91353 245 39 FTQPVFRGSVREGVQPGTKVMSVSATDDDD CADB_XENLA 286 39 FEADYYNISIVENLPTGFSVLQVNAVDRDQ Q9VEU1 375 43 FEQQSYSAVVEENSEIGTSVERVHATDLDT Q9VGG5 766 465 FAESSLALEIQEDAAPGTLLIKLTATDPDQ Q9NPG4 244 149 FEAEQFEASIREGATVGSTVITLRATDQDI Q9V5N8 464 39 FTQSVTEVAFPENNKPGEVIAEITASDADS Q08174 472 158 FTQDTFRGSVLEGVLPGTSVMQVTATDEDD CAD3_HUMAN 215 39 IQKTLATFRLTESARIGTVVHCLHATDADS Q9VW71 874 39 FSQTIYNASVLENSEQDTIITHVQAVDVDS Q9VFH5 510 166 FTNAPYSATVPENTPAGVSILTVKAVDGDV Q9VVG0 245 159 FPVEEQRVLIYESRLPDSVFPLEGASDADV Q9NRT8 142 40 FREGPYIGHVMEGSPTGTTVMRMTAFDADD CADD_HUMAN 245 39 FTQKLYSFTVQENSRIGSIVGEVCATDLDE DSC2_MOUSE 243 39 FTQTAYKAAFDENVPIGTTIMSLSAVDPDE FATH_HUMAN 463 250 FEHSSLKVELSEDSPIGSRVLKVHAFDPDA O93508 234 151 FETKLTVFSVPENCRSGTSVGQVTAIDKDE DSC1_MOUSE 242 39 FREGPYIGHVMEGSPTGTTVMRMTAFDADD Q9WTR5 245 39 FEHRVTIFTVPENCRSGTSVGKVTATDLDE DSC1_HUMAN 242 39 FEKDSYFGEIREDAPIGTTVLSVFARDLDS Q19482 270 39 FTQDTFRGSVLEGVMPGTSVMQVTATDEDD CAD3_MOUSE 207 39 FRGREQIIFIPESRLLNSRFPIEGAADADI Q9NRT7 133 40 FTQSFVTVSIPENNSPGIQLTKVSAMDADS Q9P2X5 466 148 FSQQVYTPNVDENAGPNTLVTTVVASDKDG O15943 858 143 FPIDVQRVEIPETAPIGWRVQISGATDPDE Q9TWY4 117 33 FPIDVQRVEIPETAPIGWRVQISGATDPDE YOG7_CAEEL 117 33 FERSTIAVDLVEDAPLGYLLLELHATDDDE O93509 238 151 FENKLTVFTVPENCRTGTSVGKVTAIDLDE DSC1_BOVIN 240 39 FNRSSYEGTLDENIPPGTSVLTVTATDQDH O88277 458 34 TQETGVTSLVPEGAARESLVALVSTSDRDS Q9WVR2 392 77 TPEAGATSLVPEGAARESLVALVSTSDRDS O95206 392 77 FTEETYTFTIFENCRVGTTVGQVCATDKDE DSC2_HUMAN 243 39 FNRSSYDGTLDENIPPGTSVLAVTATDRDH Q9NYQ8 458 34 FSSSLVEISIREDLKLHEPFYVVQASDKDK O01912 252 37 FTRPLYTAQVREDIPLNQTILKVTAVDKDT Q9XWM6 277 39 FLQSKYEGSVRQNSRPGKPFLYVNATDLDD Q12864 126 39 FSVTEQKLSIPESRLLDSRFPLEGASDADV Q9NRU2 132 40 FSQQIFMGEIEENSASNSLVMILNATDADE DSG3_HUMAN 157 39 FLQSKYEGSVRQNSRPGKPFMYVNATDLDD Q9R100 125 39 FLQTKYEGSVRQNSRPGKPFMYVNATDLDD CADL_RAT 125 39 AKKPMYIASVAENSPANVVIVKVEATDADD Q19319 1061 259 FQKPIYEVQVSEGAEINSTVTVVHAEDPEN Q9VAF5 461 257 CADHERIN3 Length of motif = 13 Motif number = 3 Cadherin motif III - 8 PCODE ST INT AYELVVTARDGGS O75286 420 148 AYELVVTARDGGS Q9Y5H8 420 148 AYELVVTARDGGS O75277 420 148 AYELVVTARDGGS Q9Y5I0 420 148 AYELVVTARDGGS O75285 420 148 AYELVVTARDGGS Q9UN74 420 148 AYELVVTARDGGS O75287 420 148 AYELVVTARDGGS Q9Y5H9 420 148 AYELVVTARDGGS O15053 420 148 AYELVVTARDGGS Q9Y5H5 420 148 AYELVVTARDGGS O75282 420 148 AYELVVTARDGGS Q9UN72 420 148 VYELVVTARDGGS O75288 420 148 VYELVVTARDGGS Q9Y5I3 420 148 VYELVVTARDGGS O75284 419 148 VYELVVTARDGGS Q9Y5H7 419 148 AYELVVTARDGGS O75279 419 147 AYELVVTARDGGS Q9Y5I1 419 147 AYELVVTARDGGS O75281 420 148 AYELVVTARDGGS Q9Y5H6 420 148 DYKVVVTARDGGS O88689 420 148 AYELVVTARDGGS O75278 420 148 AYELVVTARDGGS Q9UN75 420 148 AYELVVTARDGGS O75283 420 148 AYELVVTARDGGS Q9UN73 420 148 AYELVVTARDGGS O75280 419 148 AYELVVTARDGGS Q9Y5I2 419 148 FYELGVEARDGPG Q9Y5D1 314 42 FYELGVEARDGPG Q9Y5G7 314 42 DYQVVVTARDGGS O88690 420 148 FYEMEIQGQDGGG Q9Y5D8 315 42 FYEMEIQGQDGGG Q9Y5H2 315 42 FYEMEIQGQDGGG Q9Y5D9 315 42 FYEMEIQAEDGGG Q9Y5C9 314 42 FYEMEIQAEDGGG Q9Y5G4 314 42 FYEIKIEAQDGPG Q9Y5D4 314 42 FYEIKIEAQDGPG Q9Y5H0 314 42 FYLMEVVAQDGGA Q9Y5D2 314 42 FYLMEVVAQDGGA Q9Y5G8 314 42 QYQVVIQAKDMGG CAD6_RAT 231 42 FYEIEIQAEDGGA Q9Y5E0 318 42 FYEIEIQAEDGGA Q9Y5H3 318 42 QYQVVIQAKDMGG CAD6_HUMAN 231 42 FYQMEVQAMDNAG O60330 314 42 FYQMEVQAMDNAG Q9Y5D7 314 42 QYQVVIQAKDMGG Q90762 231 42 MYSMEVQAQDGAG Q9Y5D6 314 42 MYSMEVQAQDGAG Q9Y5H4 314 42 EYLVVIQAKDMGG O54800 239 42 QYQVVIQAKDMGG CAD6_MOUSE 231 42 SYDLDIEASDGGG Q9Y5E8 314 42 TYTLTIQAKDGGG Q9Y5E2 314 42 EYLVVIQAKDMGG Q9ULB2 239 42 EYLVVIQAIDMGG CAD8_MOUSE 239 42 YYNVEIVATDGGG Q9Y5E4 313 41 FYEMEVQAQDGPG Q9Y5D0 314 42 FYEMEVQAQDGPG Q9Y5G6 314 42 SYEVDIEAKDGGG Q9Y5E6 314 42 FYNITLTAKDGGN Q9Y5D5 417 145 FYNITLTAKDGGN Q9Y5H1 417 145 EYLVVIQAKDMGG CAD8_HUMAN 232 42 EYSIVLEARDGGG Q9UN64 312 40 EYSIVLEARDGGG Q9UN71 312 40 EYNLTITATDGGK Q9UN65 417 145 EYNLTITATDGGK Q9Y5G2 417 145 FYEMEIQAEDVGA O15039 314 42 FYEMEIQAEDVGA Q9Y5G5 314 42 SYKINIQAMDGGG Q9NRJ8 314 42 SYKINIQAMDGGG Q9Y5E1 314 42 RYTMEVEAKDGGG Q9Y5C5 314 42 RYTMEVEAKDGGG Q9Y5F9 314 42 QYQVVIQAKDMGG CADA_CHICK 232 42 EYSMVVEGRDGGG Q9Y5C6 310 38 EYSMVVEGRDGGG Q9Y5G0 310 38 TYTVNIQATDGGG Q9Y5E7 316 42 RYVLSVEAKDGGV Q9Y5C8 310 41 RYVLSVEAKDGGV Q9Y5G3 310 41 SYSIIIQATDGGG Q9Y5F1 314 42 SYHVEIEATDGGG Q9Y5E5 313 42 QYQVVIQAKDMGG Q9Y6N8 232 42 SYSIIIQATDGGG Q9Y5F2 314 42 EYHVVIQAKDMGG Q15066 231 42 EYNITVTATDQGT Q9Y5D3 417 145 EYNITVTATDQGT Q9Y5G9 417 145 SYDVDVEATDGGG Q9Y5E3 312 41 SYTINIQATDGGG Q9Y5E9 314 42 RYTINIEAKDRGS Q9UN63 314 42 RYTINIEAKDRGS Q9Y5F8 314 42 EYHVVIQAKDMGG CADB_HUMAN 231 42 EYHVVIQAKDMGG CADB_MOUSE 231 42 SYKINIQAMDGGG Q9UN67 314 42 EYHVVIQAKDMGG O93319 231 42 SYTLTVVARDRGE Q9Z1B1 428 148 YYEVIIQAKDMGG Q9Z0M3 237 42 NHNIEIAATDGGG Q63418 313 41 YYEVIIQAKDMGG Q91838 230 42 EYHVVIQAKDMGG O93264 231 42 RYEIVVEARDAQG CAD5_HUMAN 222 41 HYSVVIQAKDMAG CADM_HUMAN 231 42 QYLLVIQAKDMVG Q90763 225 42 QYLLVIQAKDMVG Q9ULB5 225 42 FYEMEVQATDNAG Q9Z1B0 310 150 TYDIDIQATDGGG Q9Y5F3 314 42 LYEMEIQAEDVGA O08963 311 42 EYNVTITATDKGN Q9Y5C7 417 145 EYNVTITATDKGN Q9Y5G1 417 145 SYEVNIEARDAGG Q9UN66 315 42 QYQVVIQAKDMGG Q9ULB4 231 42 QYTLIIQATDMEG CAD2_MOUSE 344 47 QYTLIIQATDMEG Q9Z1Y3 344 47 SYEVNIEARDAGT Q9Y5F0 315 42 QYTLIIQATDMEG CAD2_CHICK 349 47 QYTLIIQATDMEG CAD2_HUMAN 344 47 TYTLVVQAADLQG CAD1_MOUSE 342 48 YYEFDVRARDGGS Q9Y5C3 315 43 YYEFDVRARDGGS Q9Y5F7 315 43 RYEVVIQATDMAG Q63315 237 42 RYEVVIQATDMAG Q63561 237 42 RYEVVIQATDMAG Q9WTP5 237 42 RYTLIIQATDMEG CADO_XENLA 345 47 TYTLVVQAADLQG CAD1_HUMAN 340 48 TYTLVVQAADLQG Q15855 336 48 EYNLSITARDAGT O60622 422 148 EYNLSITARDAGT Q9UN70 422 148 EYNLSITARDAGT Q9Y5C4 422 148 RYEVVIQATDMAG Q9UJ99 240 42 RYTLIIQATDMEG CADN_XENLA 345 47 TYTLVVQAADLQG Q9R0T4 344 48 EYNVTIVARDGGS O14917 437 164 QYMVIVQATDMEG CAD4_CHICK 351 47 EYKIVVETQDALG CAD5_MOUSE 219 41 EYKIVVETQDALG O35542 220 41 EYNITVTARDSGL O13129 422 148 QYTLIIQATDMEG Q90275 220 47 EYNLSITARDAGT Q08192 421 147 NYTLSVVATDKGT Q24292 416 153 EYQLLVEANDQGR O35161 437 39 RYEFKVNAKDKGI O60245 604 39 RYEFKVNAKDKGI O60246 604 39 RYEFKVNAKDKGI O60247 557 39 RYEFKVNAKDKGI O88185 604 39 QYQVLIQAKDMGG CADC_HUMAN 232 42 EYTLRIRAQDGGR Q9R0M0 469 150 TYTLVVQAADLQG Q9UII7 340 48 VYNITVTATDGGI Q9Y5F4 434 147 VYNITVTATDGGI Q9Y5I4 434 147 SYELVVEASDQGQ Q9NYQ7 508 45 EYQLLVEANDQGR Q9NYQ6 422 39 QYTVIVQATDMEG CAD4_MOUSE 351 47 EYTLTVQATDLEG CADF_XENLA 356 48 VYTLTIQAADGEF CAD1_XENLA 334 48 FYEIHARARDQGQ Q9Y5C2 315 43 FYEIHARARDQGQ Q9Y5F6 315 43 SYELVVEASDQGQ O88278 499 45 NYTLIVQATDQEG CAD1_CHICK 346 48 RYEFRVVAKDKGI O57537 576 39 QYTVVIQATDMEG P79883 360 47 EYQVLITASDSGS Q9Y5F5 410 147 EYQVLITASDSGS Q9Y5I5 410 147 VYTLRIRASDWGL Q9WU10 534 40 AYEVDVQARDLGP O55134 317 43 KYNLTVVAMDQGT FAT_DROME 459 159 KYELVIEAKDMGG CADD_CHICK 326 51 KYELVIEAKDMGG Q91353 326 51 EYTLTVQAADLDG CADB_XENLA 364 48 LYNLKIIAADTGG Q9VEU1 1018 613 TYQLQIQASDQGT Q9VGG5 835 39 AYEVDVQARDLGP Q9NPG4 317 43 SYRLVIRAQDGGS Q9V5N8 654 160 SYELKVVAADRGS Q08174 543 41 EYTLTIQATDMDG CAD3_HUMAN 293 48 NYALHITAKDGGS Q9VW71 942 38 EIDLLVRARDSGI Q9VFH5 711 171 SYSLTVVAIDGGQ Q9VVG0 552 277 AHNLFLTATDGGK Q9NRT8 216 44 KYELIIEAQDMAG CADD_HUMAN 326 51 KYQLLIKVQDMDG DSC2_MOUSE 318 45 VYTLRIRASDWGL FATH_HUMAN 533 40 SYELHIQASDLGA O93508 307 43 TYKLVMEVRDMGG DSC1_MOUSE 317 45 KYELIIEAQDMAG Q9WTR5 326 51 TYQLIMEVRDMGG DSC1_HUMAN 317 45 RYSLKVTARDMGT Q19482 546 246 EYRLTVQATDMDG CAD3_MOUSE 285 48 ELHLLLTATDGGK Q9NRT7 207 44 KYLFTILAKDNGV Q9P2X5 535 39 KYELNVTAMDDGS O15943 926 38 SYTFEYEAKDLGT Q9TWY4 701 554 SYTFEYEAKDLGT YOG7_CAEEL 703 556 TYEFEVQAQDLGP O93509 311 43 TYKLIMEVRDMGG DSC1_BOVIN 315 45 IYSLKITASDGKN O88277 635 147 EYNLTLVAEDRGA Q9WVR2 462 40 EYNLTLVAEDRGA O95206 462 40 KYQLKIKVQDMDG DSC2_HUMAN 318 45 SYSLKITASDGKN Q9NYQ8 635 147 NYKLRVKATDLGI O01912 322 40 VYRFNVTARDHGE Q9XWM6 346 39 SYNLVISVKDMGG Q12864 206 50 QLKLLLTATDGGK Q9NRU2 206 44 SYRLVVSGADKDG DSG3_HUMAN 232 45 SYNLVVSVKDMGG Q9R100 205 50 YYNLVVSVKDMGG CADL_RAT 205 50 SYALTVQATDHGT Q19319 1234 143 RYQLILKAEDTGG Q9VAF5 528 37 CADHERIN4 Length of motif = 20 Motif number = 4 Cadherin motif IV - 8 PCODE ST INT SLWATASVSVEVADVNDNAP O75286 434 1 SLWATASVSVEVADVNDNAP Q9Y5H8 434 1 SLWATASVSVGVADVNDNAP O75277 434 1 SLWATASVSVGVADVNDNAP Q9Y5I0 434 1 SLWATASVSVEVADVNDNAP O75285 434 1 SLWATASVSVEVADVNDNAP Q9UN74 434 1 SLWATTSVSIEVADVNDNAP O75287 434 1 SLWATTSVSIEVADVNDNAP Q9Y5H9 434 1 SLWATARVSVEVADVNDNAP O15053 434 1 SLWATARVSVEVADVNDNAP Q9Y5H5 434 1 SLWATASVSVEVADVNDNAP O75282 434 1 SLWATASVSVEVADVNDNAP Q9UN72 434 1 SLWATARVSVEVADVNDNAP O75288 434 1 SLWATARVSVEVADVNDNAP Q9Y5I3 434 1 SLWATASVSVEVADVNDNAP O75284 433 1 SLWATASVSVEVADVNDNAP Q9Y5H7 433 1 SLWATARVSVEVADVNDNAP O75279 433 1 SLWATARVSVEVADVNDNAP Q9Y5I1 433 1 SLWATASLSVEVADVNDNAP O75281 434 1 SLWATASLSVEVADVNDNAP Q9Y5H6 434 1 SLWATASVSVEVADVNDNAP O88689 434 1 SLWATARVSVEVADVNDNAP O75278 434 1 SLWATARVSVEVADVNDNAP Q9UN75 434 1 SLWATASLSVEVADMNDNAP O75283 434 1 SLWATASLSVEVADMNDNAP Q9UN73 434 1 PLWATASVSVEVADVNDNAP O75280 433 1 PLWATASVSVEVADVNDNAP Q9Y5I2 433 1 GLRDRAKVLITILDVNDNVP Q9Y5D1 326 -1 GLRDRAKVLITILDVNDNVP Q9Y5G7 326 -1 SLWTTASVSVEVADVNDNAP O88690 434 1 GLFTTTTMLITVVDVNDNAP Q9Y5D8 327 -1 GLFTTTTMLITVVDVNDNAP Q9Y5H2 327 -1 GLFTTTTMLITVVDVNDNAP Q9Y5D9 327 -1 GLKGWTKVLISVEDVNDNRP Q9Y5C9 326 -1 GLKGWTKVLISVEDVNDNRP Q9Y5G4 326 -1 GLLSRAKILVTVLDVNDNAP Q9Y5D4 326 -1 GLLSRAKILVTVLDVNDNAP Q9Y5H0 326 -1 ALVASAKVVVTVQDVNDNAP Q9Y5D2 326 -1 ALVASAKVVVTVQDVNDNAP Q9Y5G8 326 -1 GLSGTTTVNITLTDVNDNPP CAD6_RAT 247 3 AYLATAKVLITVEDVNDNSP Q9Y5E0 330 -1 AYLATAKVLITVEDVNDNSP Q9Y5H3 330 -1 GLSGTTTVNITLTDVNDNPP CAD6_HUMAN 247 3 GYSARAKVLITVLDVNDNAP O60330 326 -1 GYSARAKVLITVLDVNDNAP Q9Y5D7 326 -1 GLSGTTTVNITLTDVNDNPP Q90762 247 3 GLMAKVKVLIKVLDVNDNAP Q9Y5D6 326 -1 GLMAKVKVLIKVLDVNDNAP Q9Y5H4 326 -1 GLSGTTTLTVTLTDVNDNPP O54800 255 3 GLSGTTTVNITLTDVNDNPP CAD6_MOUSE 247 3 GLSGKCSVSVKVLDVNDNFP Q9Y5E8 326 -1 GLSGKCTVVVDVTDINDNRP Q9Y5E2 326 -1 GLSGTTTLTVTLTDVNDNPP Q9ULB2 255 3 GLSGTTTLTVTLTDVNDNPP CAD8_MOUSE 255 3 GLSGKCTVAIEVVDVNDNAP Q9Y5E4 325 -1 GSLTKAKVLITVLDVNDNAP Q9Y5D0 326 -1 GSLTKAKVLITVLDVNDNAP Q9Y5G6 326 -1 GLSGKSTVIVQVVDVNDNPP Q9Y5E6 326 -1 SLSTDAHILLQVADINDNAP Q9Y5D5 431 1 SLSTDAHILLQVADINDNAP Q9Y5H1 431 1 GLSGTTTLTVTLTDVNDNPP CAD8_HUMAN 248 3 GMIAQCTVEVEVIDENDNAP Q9UN64 324 -1 GMIAQCTVEVEVIDENDNAP Q9UN71 324 -1 PLSSSIIVTLHISDVNDNAP Q9UN65 431 1 PLSSSIIVTLHISDVNDNAP Q9Y5G2 431 1 ALLGRTKLLISVEDVNDNRP O15039 326 -1 ALLGRTKLLISVEDVNDNRP Q9Y5G5 326 -1 GLSARCTVLIKVLDSNDNPP Q9NRJ8 326 -1 GLSARCTVLIKVLDSNDNPP Q9Y5E1 326 -1 GLSTQCKVIIEILDENDNSP Q9Y5C5 326 -1 GLSTQCKVIIEILDENDNSP Q9Y5F9 326 -1 GLSGTTTVNITLTDVNDNPP CADA_CHICK 248 3 GLVAQCTVEINIQDENDNSP Q9Y5C6 322 -1 GLVAQCTVEINIQDENDNSP Q9Y5G0 322 -1 GLSGTCVVFVQVMDLNDNPP Q9Y5E7 328 -1 ALSSRTSITLHISDINDNAP Q9Y5C8 427 104 ALSSRTSITLHISDINDNAP Q9Y5G3 427 104 GLFGKSTVRIQVMDVNDNAP Q9Y5F1 326 -1 GLSGKGTVVIEVVDVNDNPP Q9Y5E5 325 -1 GLSGTTTVNITLTDVNDNPP Q9Y6N8 248 3 GLFGKSTVIIHVIDVNDNAP Q9Y5F2 326 -1 GLSGTTKVTITLTDVNDNPP Q15066 247 3 PLSTETHISLQVMDINDNPP Q9Y5D3 431 1 PLSTETHISLQVMDINDNPP Q9Y5G9 431 1 GLSGKCSLVVRVLDVNDNAP Q9Y5E3 324 -1 GLSGKCTLLVKVMDINDNPP Q9Y5E9 326 -1 PLSSSKTITLHITDVNDNAP Q9UN63 431 104 PLSSSKTITLHITDVNDNAP Q9Y5F8 431 104 GLSGTTKVTITLTDVNDNPP CADB_HUMAN 247 3 GLSGTTKVTITLTDVNDNPP CADB_MOUSE 247 3 GLSARCRVLVEVLDTNDNPP Q9UN67 326 -1 GLSGTTKVTITLTDVNDNPP O93319 247 3 ALSTSKSIQVQVSDVNDNAP Q9Z1B1 442 1 GLAGTTTVNITLSDVNDNPP Q9Z0M3 253 3 GLSGKCTVAVQVLDVNDNAP Q63418 325 -1 GLAGTTTVNVTLSDVNDNPP Q91838 246 3 GLSGTTKVTITLTDVNDNPP O93264 247 3 GDSGTATVLVTLQDINDNFP CAD5_HUMAN 237 2 GLSGSTTVNITLTDVNDNPP CADM_HUMAN 247 3 GLSGTTSVTVTLTDVNDNPP Q90763 241 3 GLSGTTSVTVTLTDVNDNPP Q9ULB5 241 3 GYSARAKVLVTVLDVNDNAP Q9Z1B0 322 -1 GLSAHSKVLVEVVDVNDNPP Q9Y5F3 326 -1 ALLGRSKVVIMVEDVNDNRP O08963 323 -1 PLSSSKTITLHILDVNDNVP Q9Y5C7 431 1 PLSSSKTITLHILDVNDNVP Q9Y5G1 431 1 GFSGKCTVLIQVIDVNDHAP Q9UN66 327 -1 GLSGTTTVNITLTDVNNNPP Q9ULB4 247 3 GLSNTATAVITVTDVNDNPP CAD2_MOUSE 361 4 GLSNTATAVITVTDVNDNPP Q9Z1Y3 361 4 TFSGKCTVLIQVIDVNDHAP Q9Y5F0 327 -1 GLSNTATAVITVTDVNDNPP CAD2_CHICK 366 4 GLSNTATAVITVTDVNDNPP CAD2_HUMAN 361 4 GLSTTAKAVITVKDINDNAP CAD1_MOUSE 356 1 PLSTHRTIFLNISDVNDNPP Q9Y5C3 434 106 PLSTHRTIFLNISDVNDNPP Q9Y5F7 434 106 GLSGSTTVTIVVTDVNDNPP Q63315 253 3 GLSGSTTVTIVVTDVNDNPP Q63561 253 3 GLSGSTTVTIVVTDVNDNPP Q9WTP5 253 3 GLSNTATAVIAVTDVNDNPP CADO_XENLA 362 4 GLSTTATAVITVTDTNDNPP CAD1_HUMAN 354 1 GLSTTATAVITVTDTNDNPP Q15855 350 1 SLSALTIVRVQVSDINDNPP O60622 436 1 SLSALTIVRVQVSDINDNPP Q9UN70 436 1 SLSALTIVRVQVSDINDNPP Q9Y5C4 436 1 GLSGSTTVTIVVTDVNDNPP Q9UJ99 256 3 GLSNTATAVIAVTDVNDNPP CADN_XENLA 362 4 GLSTTAKAVITVKDINDNAP Q9R0T4 358 1 PLNSTKSFAIKILDXNDNPP O14917 451 1 GLSNTATAIITVTDVNDNPP CAD4_CHICK 368 4 GESGTATVMIRLEDINDNFP CAD5_MOUSE 234 2 GESGTATVMIRLEDINDNFP O35542 235 2 PLSAVKHILVQVSDVNDNAP O13129 436 1 GLSNTATAVIRLLDVNDNAP Q90275 237 4 SLSALTIVRVQVSDINDNPP Q08192 435 1 PLSSTATVLVTIHDVNDNEP Q24292 537 108 PLSASATVHIVVEDENDNYP O35161 453 3 VLQGSTTVIVQVADKNDNDP O60245 618 1 VLQGSTTVIVQVADKNDNDP O60246 618 1 VLQGSTTVIVQVADKNDNDP O60247 571 1 VLQGSTTVIVQVADKNDNDP O88185 618 1 GLAGTTIVNITLTDVNDNPP CADC_HUMAN 248 3 ALTASASVSVTILDVNDNNP Q9R0M0 590 108 GLSTTATAVITVTDTNDNPP Q9UII7 354 1 QLTSLRTLKVEISDINDNPP Q9Y5F4 448 1 QLTSLRTLKVEISDINDNPP Q9Y5I4 448 1 PLSASASVTVTVLDVNDNRP Q9NYQ7 735 214 PLSATATVYIEVEDENDNYP Q9NYQ6 438 3 GLSNTATAIITVTDVNDNPP CAD4_MOUSE 368 4 GLSVEGKAIIQITDANDNAP CADF_XENLA 370 1 DRTTTATALIVVMDTNDNPP CAD1_XENLA 349 2 SLHKHLTIRLNISDVNDNAP Q9Y5C2 433 105 SLHKHLTIRLNISDVNDNAP Q9Y5F6 433 105 PRSATVRVHITVLDENDNAP O88278 515 3 GLSNTATAIIEVTDANDNIP CAD1_CHICK 360 1 VLQGATSVVVQVADRNDNEP O57537 590 1 GLSNTATAIITVADVNDNPP P79883 377 4 PLSTRRTITVSVADVNDNTP Q9Y5F5 424 1 PLSTRRTITVSVADVNDNTP Q9Y5I5 424 1 WLSSTVLLKVSLDDVNDNPP Q9WU10 907 360 PLSAEKELQIQVSDVNDNAP O55134 439 109 PQSATATVWLNVADVNDNDP FAT_DROME 687 215 GLTGTATATILIDDKNDHPP CADD_CHICK 342 3 GLTGTATATILIDDKNDHPP Q91353 342 3 GLTAEGKAVIEITDANDNAP CADB_XENLA 378 1 GLSGYAHLTVLVADVNDNAP Q9VEU1 1030 -1 ALTATADVVVDIINLNDNDP Q9VGG5 1058 210 PLSAKKQLSIQISDINDNAP Q9NPG4 439 109 PKSASSSVVITVQDVNDNDP Q9V5N8 773 106 SLQGTATVLVNVLDCNDNDP Q08174 557 1 GSTTTAVAVVEILDANDNAP CAD3_HUMAN 307 1 VLSSEALVYVLVDDVNDNAP Q9VW71 956 1 MLSTVVPVLIYVQDVNDNAP Q9VFH5 725 1 PETATTTVYVNVKDINDERP Q9VVG0 794 229 ELTGTVQLLVTVLDVNDNAP Q9NRT8 230 1 GLTGTATATIMIDDKNDHSP CADD_HUMAN 342 3 GLHTTAKCIITIEDVNDNLP DSC2_MOUSE 334 3 QLFSTVVVKVSLEDVNDNPP FATH_HUMAN 906 360 SVSSTCRAIVDIIDVNDNAP O93508 321 1 GLFTTGTITISLEDENDNSP DSC1_MOUSE 333 3 GLTGTATATIVIDDKNDHSP Q9WTR5 342 3 GLFNTGTITISLEDENDNPP DSC1_HUMAN 333 3 SLNTSTTIAVVLKDINDNAP Q19482 560 1 GSTTTAEAVVQILDANDNAP CAD3_MOUSE 299 1 ELQGTVELLITVLDVNDNAP Q9NRT7 221 1 PLTSNVTVFVSIIDQNDNSP Q9P2X5 549 1 SLEGVCSFTVEITDVNDNPP O15943 1057 118 SLSATSKILIHVGDINDNTP Q9TWY4 1731 1017 SLSATSKILIHVGDINDNTP YOG7_CAEEL 1735 1019 PLTATCKVTVHILDVNDNTP O93509 325 1 GLFNTGTITISLEDENDNAP DSC1_BOVIN 331 3 PKSSWKLLTVTVKDWNDNPP O88277 799 151 PLRTVRPYTVRVGDENDNAP Q9WVR2 476 1 PLRTVRPYTVRVGDENDNAP O95206 476 1 GLQTTSTCIINIDDVNDHLP DSC2_HUMAN 334 3 QKSSWKLLTVNVKDWNDNAP Q9NYQ8 799 151 PRSSNMTLFIHVLDVNDNAP O01912 336 1 PLIGFCQFSVEVVDINDNSP Q9XWM6 593 234 PLSYPLEIHVKVKDINDNPP Q12864 319 100 EFTGSVSLLILVLDANDNAP Q9NRU2 220 1 GLSTQCECNIKVKDVNDNFP DSG3_HUMAN 246 1 PLAYPLEIYVKVIDINDNPP Q9R100 318 100 PLAYPLEIRVKVIDINDNPP CADL_RAT 318 100 NMKSFATFSVNINDENDNSP Q19319 1461 214 GLSSSATVNIKVTDINDKNP Q9VAF5 540 -1 CADHERIN5 Length of motif = 14 Motif number = 5 Cadherin motif V - 8 PCODE ST INT PAFSQSEYTVFVKE O75286 453 -1 PAFSQSEYTVFVKE Q9Y5H8 453 -1 PAFAQPEYTVFVKE O75277 453 -1 PAFAQPEYTVFVKE Q9Y5I0 453 -1 PAFAQPEYTVFVKE O75285 453 -1 PAFAQPEYTVFVKE Q9UN74 453 -1 PAFAQPEYTVFVKE O75287 453 -1 PAFAQPEYTVFVKE Q9Y5H9 453 -1 PAFAQSEYTVFVKE O15053 453 -1 PAFAQSEYTVFVKE Q9Y5H5 453 -1 PAFAQPEYTVFVKE O75282 453 -1 PAFAQPEYTVFVKE Q9UN72 453 -1 PAFAQPEYTVFVKE O75288 453 -1 PAFAQPEYTVFVKE Q9Y5I3 453 -1 PAFAQPQYTVFVKE O75284 452 -1 PAFAQPQYTVFVKE Q9Y5H7 452 -1 PAFAQPEYTVFVKE O75279 452 -1 PAFAQPEYTVFVKE Q9Y5I1 452 -1 PAFAQPEYTVFVKE O75281 453 -1 PAFAQPEYTVFVKE Q9Y5H6 453 -1 PVFAQPEYTVFVKE O88689 453 -1 PAFAQPEYTVFVKE O75278 453 -1 PAFAQPEYTVFVKE Q9UN75 453 -1 PAFAQPEYTVFVKE O75283 453 -1 PAFAQPEYTVFVKE Q9UN73 453 -1 PAFAQSEYTVFVKE O75280 452 -1 PAFAQSEYTVFVKE Q9Y5I2 452 -1 PTFPHSSYSVYVLE Q9Y5D1 450 104 PTFPHSSYSVYVLE Q9Y5G7 450 104 PSFAQPDYTVFVKE O88690 453 -1 PVFPHSSYSAYIPE Q9Y5D8 451 104 PVFPHSSYSAYIPE Q9Y5H2 451 104 PVFPHSSYSAYIPE Q9Y5D9 451 104 PAFSQASYSVYLPE Q9Y5C9 450 104 PAFSQASYSVYLPE Q9Y5G4 450 104 PTFPHLSYSAYIPE Q9Y5D4 450 104 PTFPHLSYSAYIPE Q9Y5H0 450 104 PNFPQASYSTSVTE Q9Y5D2 450 104 PNFPQASYSTSVTE Q9Y5G8 450 104 PRFPQSTYQFKTPE CAD6_RAT 266 -1 PTFSQVSYFTYIPE Q9Y5E0 454 104 PTFSQVSYFTYIPE Q9Y5H3 454 104 PRFPQSTYQFKTPE CAD6_HUMAN 266 -1 PVFPQASYSAYIPE O60330 450 104 PVFPQASYSAYIPE Q9Y5D7 450 104 PRFPQSTYQFRAPE Q90762 266 -1 PVFHQDSYSAYIPE Q9Y5D6 450 104 PVFHQDSYSAYIPE Q9Y5H4 450 104 PKFAQSLYHFSVPE O54800 274 -1 PRFPQSTYQFKTPE CAD6_MOUSE 266 -1 PAFTQTSYTLFVRE Q9Y5E8 449 103 PAFTQTSYTLFVRE Q9Y5E2 449 103 PKFAQSLYHFSVPE Q9ULB2 274 -1 PKFAQSLYHFSVPE CAD8_MOUSE 274 -1 PAFTQTSYTLFVRE Q9Y5E4 448 103 PTFPHSSYSVYIAE Q9Y5D0 450 104 PTFPHSSYSVYIAE Q9Y5G6 450 104 PAFTQISYTLFVRE Q9Y5E6 449 103 PAFSRTSYSTYIPE Q9Y5D5 450 -1 PAFSRTSYSTYIPE Q9Y5H1 450 -1 PKFAQSLYHFSVPE CAD8_HUMAN 267 -1 PVFSQSSYIVHVAE Q9UN64 448 104 PVFSQSSYIVHVAE Q9UN71 448 104 PVFQQTSYMVHVAE Q9UN65 450 -1 PVFQQTSYMVHVAE Q9Y5G2 450 -1 PTFPHASYSAYILE O15039 450 104 PTFPHASYSAYILE Q9Y5G5 450 104 PAFTQTSYTLFVRE Q9NRJ8 449 103 PAFTQTSYTLFVRE Q9Y5E1 449 103 PVFDQTSYVVHVAE Q9Y5C5 450 104 PVFDQTSYVVHVAE Q9Y5F9 450 104 PRFPQSTIHLRIPE CADA_CHICK 267 -1 PVFHQASYLVSVPE Q9Y5C6 446 104 PVFHQASYLVSVPE Q9Y5G0 446 104 PAFTQTSYTLFVRE Q9Y5E7 451 103 PVFHQASYVVHVSE Q9Y5C8 446 -1 PVFHQASYVVHVSE Q9Y5G3 446 -1 PAFTQTSYALFVRE Q9Y5F1 449 103 PAFTQTSYTLFVRE Q9Y5E5 448 103 PRFPQNTIHLRVLE Q9Y6N8 267 -1 PTFTQTSYTLFVRE Q9Y5F2 449 103 PKFPQSVYQISVSE Q15066 266 -1 PTFPHASYSAYIPE Q9Y5D3 450 -1 PTFPHASYSAYIPE Q9Y5G9 450 -1 PAFTQTSYTLFVRE Q9Y5E3 447 103 PTFTQTSYTLFVRE Q9Y5E9 449 103 PVFGQSAYLVHVPE Q9UN63 450 -1 PVFGQSAYLVHVPE Q9Y5F8 450 -1 PKFPQRLYQMSVSE CADB_HUMAN 266 -1 PKFPQSVYQMSVSE CADB_MOUSE 266 -1 PAFTQTSYTLFVRE Q9UN67 449 103 PKFPQSVYQMSVSE O93319 266 -1 PRFSQPVYDVYVTE Q9Z1B1 461 -1 PRFPQKHYQMSVLE Q9Z0M3 272 -1 PAFTQTSYTMFVHE Q63418 448 103 PRFPQKHYQMSVLE Q91838 265 -1 PKFPQSAYPMSVSE O93264 266 -1 PFFTQTKYTFVVPE CAD5_HUMAN 256 -1 PRFPQKHYQLYVPE CADM_HUMAN 266 -1 PRFPRRSYQYNVPE Q90763 260 -1 PRFPRRSYQYNVPE Q9ULB5 260 -1 PVFLQASYWAYIPE Q9Z1B0 446 104 PIFREDSYILTVRE Q9Y5F3 450 104 PRFPHTSYTAYIPE O08963 446 103 PVFHQASYTVHVAE Q9Y5C7 450 -1 PVFHQASYTVHVAE Q9Y5G1 450 -1 PAFTQTSYTLFVRE Q9UN66 450 103 PRFPQSTYQFNSPE Q9ULB4 266 -1 PEFTAMTFYGEVPE CAD2_MOUSE 380 -1 PEFTAMTFYGEVPE Q9Z1Y3 380 -1 PAFTQTSYTLFVRE Q9Y5F0 449 102 PEFTAMTFYGEVPE CAD2_CHICK 385 -1 PEFTAMTFYGEVPE CAD2_HUMAN 380 -1 PVFNPSTYQGQVPE CAD1_MOUSE 375 -1 PSFFQRSHEVFVPE Q9Y5C3 453 -1 PSFFQRSHEVFVPE Q9Y5F7 453 -1 PRFPQKMYQFSIQE Q63315 272 -1 PRFPQKMYQFSIQE Q63561 272 -1 PRFPQKMYQFSIQE Q9WTP5 272 -1 PEFTAMTFYGEVPE CADO_XENLA 381 -1 PIFNPTTYKGQVPE CAD1_HUMAN 373 -1 PIFNPTTYKGQVPE Q15855 369 -1 PQSSQSSYDVYIEE O60622 455 -1 PQSSQSSYDVYIEE Q9UN70 455 -1 PQSSQSSYDVYIEE Q9Y5C4 455 -1 PRFPQKMYQFSIQE Q9UJ99 275 -1 PEFTAMTFYGEVPE CADN_XENLA 381 -1 PIFNPSTYQGQVLE Q9R0T4 377 -1 PRFTKGLYVLQVHE O14917 470 -1 PEFTTSTYSGEVPE CAD4_CHICK 387 -1 PVFTQSTYTFSVPE CAD5_MOUSE 253 -1 PVFTQSTYTFSVPE O35542 254 -1 PKSSQDSYDVYVLE O13129 455 -1 PEFTRETFHGEVPE Q90275 256 -1 PQSSQSSYDVYIEE Q08192 454 -1 PIFDQSFYNVSVAE Q24292 556 -1 PQFSEKRYVVQVPE O35161 472 -1 PKFMQDVFTFYVKE O60245 637 -1 PKFMQDVFTFYVKE O60246 637 -1 PKFMQDVFTFYVKE O60247 590 -1 PKFMQDVFTFYVKE O88185 637 -1 PRFPKSIFHLKVPE CADC_HUMAN 267 -1 PTFTQPEYTVRLNE Q9R0M0 609 -1 PIFNPTTYKGQVPE Q9UII7 373 -1 PSFLEDSYSIYIQE Q9Y5F4 467 -1 PSFLEDSYSIYIQE Q9Y5I4 467 -1 PVFQSAHYSVSVNE Q9NYQ7 856 101 PQFSEQNYVVQVPE Q9NYQ6 457 -1 PEFTTSTFAGEVPE CAD4_MOUSE 387 -1 PIFDPKTYTALVPE CADF_XENLA 389 -1 PVFDPTQYTAKVPE CAD1_XENLA 368 -1 PRFNQQLYTAYILE Q9Y5C2 452 -1 PRFNQQLYTAYILE Q9Y5F6 452 -1 PQFSEKRYVAQVRE O88278 534 -1 PIFNPTMYEGVVEE CAD1_CHICK 379 -1 PKFMQDVFTFYVKE O57537 609 -1 PEFTRKMFIGEVPE P79883 396 -1 PNFPQPQQELFVAE Q9Y5F5 443 -1 PNFPQPQQELFVAE Q9Y5I5 443 -1 PRFIPPSYSVKVRE Q9WU10 926 -1 PVFEKSRYEVSTWE O55134 458 -1 PVFDHTSYETSLPE FAT_DROME 1047 340 PEFTKKEFQATVKE CADD_CHICK 361 -1 PEFTKKEFQATVKE Q91353 361 -1 PIFDPKTYTALVPE CADB_XENLA 397 -1 PTFKKSWYSFDTPE Q9VEU1 1246 196 PKFSQSDYYFNVTE Q9VGG5 1077 -1 PVFEKSRYEVSTRE Q9NPG4 458 -1 PIFENAPYSASVFE Q9V5N8 895 102 PKFMLSGYNFSVME Q08174 576 -1 PMFDPQKYEAHVPE CAD3_HUMAN 326 -1 PVFGVQEYIFKVRE Q9VW71 975 -1 PIFQQSFYAKTVPE Q9VFH5 744 -1 PKFEQNSYATYVSE Q9VVG0 813 -1 PTFEQSEYEVRIFE Q9NRT8 249 -1 PKFTKKEFQATVEE CADD_HUMAN 361 -1 PTFTRTTYVTSVEE DSC2_MOUSE 353 -1 PTFIPPNYRVKVRE FATH_HUMAN 925 -1 PLFSKSIYDVSVIE O93508 451 110 PYFTQTSYTTEVEE DSC1_MOUSE 352 -1 PKFTKKEFQARVEE Q9WTR5 361 -1 PSFTETSYVTEVEE DSC1_HUMAN 352 -1 PTFDKKEYNVTISE Q19482 579 -1 PEFEPQKYEAWVPE CAD3_MOUSE 318 -1 PLFDQAVYRVHLLE Q9NRT7 240 -1 PVFTHNEYNFYVPE Q9P2X5 568 -1 PYFDKSLYEAEVDE O15943 1412 335 PRFDQQLYRFNVTE Q9TWY4 2039 288 PRFDQQLYRFNVTE YOG7_CAEEL 2043 288 PVFSKPQYEASILE O93509 455 110 PYFTETSYTVEVEE DSC1_BOVIN 350 -1 PRFPPGGYQLTISE O88277 818 -1 PLFTKPVYEVSVRE Q9WVR2 495 -1 PLFTRPVYEVSVRE O95206 495 -1 PTFTRTSYVTSVEE DSC2_HUMAN 353 -1 PRFPPGGYQLTISE Q9NYQ8 818 -1 PEFEKSWYTMEVLE O01912 355 -1 PSFEEQKYIGRVKE Q9XWM6 985 372 PQFSQHVFQAKVSE Q12864 564 225 PIFDRPVYEVKMYE Q9NRU2 239 -1 PMFRDSQYSARIEE DSG3_HUMAN 265 -1 PVFPQRIFQANVSE Q9R100 563 225 PVFPQQIFQANVSE CADL_RAT 563 225 PVFEKLKYTASTPE Q19319 2199 718 LAFSDDSYTTSVPE Q9VAF5 892 332 CADHERIN6 Length of motif = 27 Motif number = 6 Cadherin motif VI - 8 PCODE ST INT ESGKVYALQPLDHEELELLQFQVSARD O75286 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9Y5H8 513 46 ESGKVYALQPLDHEELELLQFQVSARD O75277 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I0 513 46 ESGKVYALQPLDHEELELLQFQVTARD O75285 513 46 ESGKVYALQPLDHEELELLQFQVTARD Q9UN74 513 46 ESGKVYALQPLDHEEVELLQFQVSARD O75287 513 46 ESGKVYALQPLDHEEVELLQFQVSARD Q9Y5H9 513 46 ESGKVYALQPLDHEELELLQFQVSARD O15053 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9Y5H5 513 46 ESGKVYALQPLDHEELELLQFQVSARD O75282 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9UN72 513 46 ESGKVYALQPLDHEELELLQFQVSARD O75288 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I3 513 46 ESGKVYALQPLDHEEVELLQFQVSARD O75284 512 46 ESGKVYALQPLDHEEVELLQFQVSARD Q9Y5H7 512 46 ESGKVYALQPLDHEELELLQFQVSARD O75279 512 46 ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I1 512 46 ESGKVYALQPLDHEELELLQFQVSARD O75281 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9Y5H6 513 46 ESGKVFALQPLDHEELELLRFQVSARD O88689 513 46 ESGKVYALQPLDHEELELLQFQVSARD O75278 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9UN75 513 46 ESGKVYALQPLDHEELELLQFQVSARD O75283 513 46 ESGKVYALQPLDHEELELLQFQVSARD Q9UN73 513 46 ESGKVYALQPLDHEELELLQFQVSARD O75280 512 46 ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I2 512 46 DTGILYALRSFDYEQLRDLQLWVTASD Q9Y5D1 510 46 DTGILYALRSFDYEQLRDLQLWVTASD Q9Y5G7 510 46 ESGKVFALQPLDHEELELLQFQVSARD O88690 513 46 NTGVLYALQSFDYEQFRDLELRVIARD Q9Y5D8 511 46 NTGVLYALQSFDYEQFRDLELRVIARD Q9Y5H2 511 46 NTGVLYALQSFDYEQFRDLELRVIARD Q9Y5D9 511 46 DTGVLYALCSFDYEQFRDLQMQVTASD Q9Y5C9 510 46 DTGVLYALCSFDYEQFRDLQMQVTASD Q9Y5G4 510 46 NTGVLYALRSFDYEQFRDLKLLVTASD Q9Y5D4 510 46 NTGVLYALRSFDYEQFRDLKLLVTASD Q9Y5H0 510 46 DTGVLYALRSFDYEQLRDLQLWVTASD Q9Y5D2 510 46 DTGVLYALRSFDYEQLRDLQLWVTASD Q9Y5G8 510 46 QEGIITVKKLLDFEKKRVYTLKVEASN CAD6_RAT 325 45 DTGVLYALRSFDYEQFHELQMQVTASD Q9Y5E0 514 46 DTGVLYALRSFDYEQFHELQMQVTASD Q9Y5H3 514 46 QEGIITVKKLLDFEKKKVYTLKVEASN CAD6_HUMAN 325 45 DTGVLYALSSFDYEQFRDLQVKVMARD O60330 510 46 DTGVLYALSSFDYEQFRDLQVKVMARD Q9Y5D7 510 46 QEGIITVKKALDFENKNLYILKVEATN Q90762 325 45 DTGVLYALRSFDYEQFRDMQLKVMARD Q9Y5D6 510 46 DTGVLYALRSFDYEQFRDMQLKVMARD Q9Y5H4 510 46 QDGVIRLRKPLDFETKKSYTLKVEAAN O54800 333 45 QEGIITVKKLLDFEKKKVYTLRWKASN CAD6_MOUSE 325 45 DNGHLFALQSLDYEALQAFEFRVGATD Q9Y5E8 509 46 DNGHLFALRSLDYEALQAFEFRVGATD Q9Y5E2 509 46 QDGIIRLRKPLDFETKKSYTLKVEAAN Q9ULB2 333 45 QDGVIRLRKPLDFETKKSYTLKVEAAN CAD8_MOUSE 333 45 DNGHLFALRSLDYEALQAFEFRVGATD Q9Y5E4 508 46 DTGVLYALQSFDYEQLRELQLRVTAHD Q9Y5D0 510 46 DTGVLYALQSFDYEQLRELQLRVTAHD Q9Y5G6 510 46 DNGHLFALRSLDYEALQAFEFRVGATD Q9Y5E6 509 46 DTGVLYALRSFDYEQLRDLQVWVIARD Q9Y5D5 510 46 DTGVLYALRSFDYEQLRDLQVWVIARD Q9Y5H1 510 46 QDGIIRLRKPLDFETKKSYTLKDEAAN CAD8_HUMAN 326 45 ESGVVFAQRAFDHEQLRAFELTLQARD Q9UN64 508 46 ESGVVFAQRAFDHEQLRAFELTLQARD Q9UN71 508 46 QSGVVFAQRAFDHEQLRAFELTLQARD Q9UN65 510 46 QSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5G2 510 46 DTGVLYALQSFDYEQIRDLQLLVTASD O15039 510 46 DTGVLYALQSFDYEQIRDLQLLVTASD Q9Y5G5 510 46 DNGHLFALRSLDYEALQAFDFRVGASD Q9NRJ8 509 46 DNGHLFALRSLDYEALQAFDFRVGASD Q9Y5E1 509 46 QSGVVFAQRAFDHEQLRAFALTLQARD Q9Y5C5 510 46 QSGVVFAQRAFDHEQLRAFALTLQARD Q9Y5F9 510 46 QEGIITVRKPLDYETRRLYTLKVEAEN CADA_CHICK 326 45 QSGVVFAQRAFDYEQLRTFELTLQARD Q9Y5C6 506 46 QSGVVFAQRAFDYEQLRTFELTLQARD Q9Y5G0 506 46 DNGHLFALQSLDYEALQAFEFRVGAAD Q9Y5E7 511 46 QSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5C8 506 46 QSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5G3 506 46 DNGHLFALRSLDYEALQGFQFRVGATD Q9Y5F1 509 46 DNGHLFALRSLDYEALQAFEFRVGASD Q9Y5E5 508 46 QEGIITVKKPLDYESRRLYTLKVEAEN Q9Y6N8 326 45 DNGHLFALRSLDYEALQAFDFRVGATD Q9Y5F2 509 46 QEGVIKLKKPVDFETKRAYSLKVEAAN Q15066 325 45 NTGILYALCSFDYEQFRDLQLLMTASD Q9Y5D3 510 46 NTGILYALCSFDYEQFRDLQLLMTASD Q9Y5G9 510 46 DNGHLFALRSLDYEALQSFEFRVGATD Q9Y5E3 507 46 DNGHLFALRSLDYEALQEFEFRVGATD Q9Y5E9 509 46 QSGVVFAQRAFDHEQLRTFELTLQARD Q9UN63 510 46 QSGVVFAQRAFDHEQLRTFELTLQARD Q9Y5F8 510 46 QEGVIKLKKPVDFETERAYSLKVEAAN CADB_HUMAN 325 45 QDGVVKLKKPVDFETKRAYSLKIEAAN CADB_MOUSE 325 45 DNGHLFALRSLDYEALQAFEFRVGATD Q9UN67 509 46 QEGVVKLKKVLDFETKKSYSLKVEAAN O93319 325 45 DNGYLYALRSFDYEQIKDFSFQVEARD Q9Z1B1 521 46 QVGIITVKKPLSFESKKSYTLKVEGSN Q9Z0M3 331 45 DNGQLFALRALDYEALQSFEFYVGATD Q63418 508 46 QVGVITVKKPLDFETKKSYTLKIEGSN Q91838 324 45 QEGVVKLKKVVDYETKKFYSMKVEAVN O93264 325 45 NEGIIKPMKPLDYEYIQQYSFIVEATD CAD5_HUMAN 315 45 NTGTIRTTKVLDREETPWYNITVTASE CADM_HUMAN 436 156 QEGIITIQKELDFEAKTSYTLRIEAAN Q90763 319 45 QEGIITIQKELDFEAKTSYTLRIEAAN Q9ULB5 319 45 DTGVLYALHSFDYEQFPDLQLQVIARD Q9Z1B0 506 46 GNGKLYALRTMDYEAIQDFQFVVKATD Q9Y5F3 510 46 DTGVLYALHSFDFEKIQDLQLLVVATD O08963 506 46 RSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5C7 510 46 RSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5G1 510 46 DNGHLFALRSLDYEALQAFEFRVGASD Q9UN66 510 46 QEGIITVKQNLDFENQMLYTLRVDASN Q9ULB4 325 45 NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_MOUSE 440 46 NDGLVTVVKPIDFETNRMFVLTVAAEN Q9Z1Y3 440 46 DNGHLFALRSLDYEALQGFQFRVGASD Q9Y5F0 509 46 NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_CHICK 445 46 NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_HUMAN 440 46 NDGILKTAKGLDFEAKQQYILHVRVEN CAD1_MOUSE 434 45 QTGAVHATRSFDYEQTQTLQFEVQARD Q9Y5C3 513 46 QTGAVHATRSFDYEQTQTLQFEVQARD Q9Y5F7 513 46 QEAIIVVQKHLDFESQQVHTVVLEALN Q63315 333 47 QEAIIVVQKHLDFESQQVHTVVLEALN Q63561 333 47 QEAIIVVQKHLDFESQQVHTVVLEALN Q9WTP5 333 47 NDGLVTVVKPIDYETKSTYILTVVAEN CADO_XENLA 441 46 NDGILKTAKGLDFEAKQQYILHVAVTN CAD1_HUMAN 432 45 NDGILKTAKGLDFEAKQQYILHVAVTN Q15855 428 45 DNGIVSSLVPLDYEDRREFELTAHISD O60622 515 46 DNGIVSSLVPLDYEDRREFELTAHISD Q9UN70 515 46 DNGIVSSLVPLDYEDRREFELTAHISD Q9Y5C4 515 46 QEAIIVVQKRLDFESQPVHTVILEALN Q9UJ99 336 47 NDGLVTVVKPIDYETKSTYILTVVAEN CADN_XENLA 441 46 NEGILKTAKGLDFEAKQQYILHVTVEN Q9R0T4 436 45 TNGAIYALRSFNFEQTKAFEFKVLAKD O14917 530 46 NEGMVTVVKAVDYEMNRAFMLTVMVSN CAD4_CHICK 447 46 NEGIIKPTKSLDYEVIQQYTFYIEATD CAD5_MOUSE 312 45 NEGIIKPTKSLDYEVIQQYTFYIEATD O35542 313 45 ESGALHLLTSLDHEDQMEFSMMVQVQD O13129 512 43 NEGLVTVVKPVDFEMNRSFMLTVVADN Q90275 316 46 DNGIVSSLVPLDYEDRREFELTAHISD Q08192 514 46 RSGHLILSQHLDYESSQRHTLIVTATD Q24292 931 361 LSGSLDVINPLDFEAIREYTLRIKAQD O35161 527 41 DTGTIYSTMSFDREHQTTYTFRVKAVD O60245 690 39 DTGTIYSTMSFDREHQTTYTFRVKAVD O60246 690 39 DTGTIYSTMSFDREHQTTYTFRVKAVD O60247 643 39 DTGTIYSTMSFDREHQTTYTFRVKAVD O88185 690 39 QEGVIKLKKPLDFETKKAYTFKVEASN CADC_HUMAN 326 45 DTGAVTTQAELDYEDQVSYTLAITARD Q9R0M0 764 141 HSCSYPCPLGLDFEAKQQYILHVAVTN Q9UII7 451 64 ASGSLYAVNSFDYEKFREFFVTVEAQD Q9Y5F4 527 46 ASGSLYAVNSFDYEKFREFFVTVEAQD Q9Y5I4 527 46 DSGAITLQAPLDYEDQVTYTLAITARD Q9NYQ7 909 39 LSGILDVINPLDFEDVQKYSLSIKAQD Q9NYQ6 512 41 NEGMVTVVKAVDYELNRAFMLTVMVSN CAD4_MOUSE 447 46 NQGILTTAKGLDFELRKQYVLQITVEN CADF_XENLA 448 45 NIGLLKTVKGLDYELKKQYILSVIVTN CAD1_XENLA 427 45 EDGRIFAQRTFDYELLQMLQIVVGVRD Q9Y5C2 512 46 EDGRIFAQRTFDYELLQMLQIVVGVRD Q9Y5F6 512 46 LTGEIQVMAPLDFEAEREYALRIRAQD O88278 589 41 NNGILKTAKGLDYETKSRYDLVVTVEN CAD1_CHICK 439 46 ETGTIYSTVSFDREHQTSYTFRVKAVD O57537 662 39 NEGIVTVSKPVDYEMSKVFPLIVMVTN P79883 456 46 SSGAITAKTSFDFEQLRGFHFQVEGRD Q9Y5F5 503 46 SSGAITAKTSFDFEQLRGFHFQVEGRD Q9Y5I5 503 46 LSGAVRIVQQLDFEKKQLYNLTVRAKD Q9WU10 980 40 ETGEVTAQRSLDYEQMAGFEFQVIAED O55134 513 41 PDGYLFVRAPLDREERDYYALTVSCRD FAT_DROME 1101 40 NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_CHICK 420 45 NEGMLSVVKPLDYEISAFHTLLIKVEN Q91353 420 45 NQGILTTAKGLDFEVRKQYVIQITVEN CADB_XENLA 456 45 ASGVLKIGGQLDRELKDKYSFQVIATD Q9VEU1 1299 39 GNVMVANSSILDREQIKELTLSVVAQD Q9VGG5 1133 42 NTGEVTAQRSLNYEEMAGFEFQVIAED Q9NPG4 513 41 QTGAIVTNAPLDRETTSGYLLTVTAKD Q9V5N8 955 46 GTGTILSSLSFDREQQSTYTFQLKAVD Q08174 629 39 NQGILTTRKGLDFEAKNQHTLYVEVTN CAD3_HUMAN 386 46 HTGAIRTQGYLDYENKQVHNLIVSAID Q9VW71 1031 42 DTGVLTVADRLDRESKDSYNLVIEAWD Q9VFH5 1158 400 GEIIVASGQTIDRERTPRIQLQIKAED Q9VVG0 1115 288 NYYSLVLDSALDRESVSAYELVVTARD Q9NRT8 412 149 NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_HUMAN 420 45 NEGILCVIKPLDYEERQQVTLQIGVVN DSC2_MOUSE 413 46 LSGAVRIVQQLDFEKKQVYNLTVRAKD FATH_HUMAN 979 40 HSGSLYTLRSFDFETLKDVQFSVKATD O93508 512 47 NEGVLCVVKPLNYEVSRQVTLQIGVLN DSC1_MOUSE 412 46 NEGMLSVVKPLDYEISAFHTLLIKVEN Q9WTR5 420 45 NEGVLCVVKPLNYEVNRQVILQVGVIN DSC1_HUMAN 412 46 SSGDISVSSDLDREDRATFSVIVTASD Q19482 765 172 NQGVLTTKKGLDFEAQDQHTLYVEVTN CAD3_MOUSE 378 46 SSGEIRLIDKLDYEETKSYEIQVKAVD Q9NRT7 298 44 QTGVIRPNISFDREKQESYTFYVKAED Q9P2X5 621 39 MTGAIYVAGALDYETRRRYELRLAASD O15943 1465 39 ESGQIESVRDLDRETKSEYHLIVEAID Q9TWY4 2090 37 ESGQIESVRDLDRETKSEYHLIVEAID YOG7_CAEEL 2094 37 DSGVLRAVRSLDYEKLKQLDFEIEAAD O93509 515 46 NEAVLCVVKPLNYEVNRQVVLQIGVLN DSC1_BOVIN 410 46 DTGMLETLAPLDREFTPYYWLTVLAVD O88277 1085 253 ATGAIYALRSFDYETLRQLDVRVQASD Q9WVR2 557 48 ATGAIYALRSFDYETLRQLDVRIQASD O95206 557 48 NEGVLCVVKPLNYEEKQQMILQIGVVN DSC2_HUMAN 413 46 LTGELVVTGHLDRESEPRYILKVEARD Q9NYQ8 871 39 FTGTIHLTAPLDFEVLPEHTLTIKATD O01912 1395 1026 DSGTIFVKEPLDFEASDQYHLVLIASD Q9XWM6 1039 40 VTGEIFSVAPLDREAGSPYRVQVVATE Q12864 615 37 NYYSLVLDSALDRERVSAYELVVTARD Q9NRU2 402 149 NEGILKVVKALDYEQLQSVKLSIAVKN DSG3_HUMAN 325 46 VTGEIFSAAPLDRETESVYRVQVVATE Q9R100 614 37 VTGDIFSTAPLDRETESVYRVQVVATE CADL_RAT 614 37 ETGDVTITGQLDYEKTQKYDLKLVATS Q19319 2249 36 HGCNLLLIQPLDFENKSSYSLQLRLTS Q9VAF5 951 45 CADHERIN7 Length of motif = 18 Motif number = 7 Cadherin motif VII - 8 PCODE ST INT SNVTLQVFVLDENDNAPA O75286 547 7 SNVTLQVFVLDENDNAPA Q9Y5H8 547 7 SNVTLQVFVLDENDNAPA O75277 547 7 SNVTLQVFVLDENDNAPA Q9Y5I0 547 7 SNVTLQVFVLDENDNAPA O75285 547 7 SNVTLQVFVLDENDNAPA Q9UN74 547 7 SNVTLQVFVLDENDNAPA O75287 547 7 SNVTLQVFVLDENDNAPA Q9Y5H9 547 7 SNVTLQVFVLDENDNAPA O15053 547 7 SNVTLQVFVLDENDNAPA Q9Y5H5 547 7 SNVTLQVFVLDENDNAPA O75282 547 7 SNVTLQVFVLDENDNAPA Q9UN72 547 7 SNVTLQVFVLDENDNAPA O75288 547 7 SNVTLQVFVLDENDNAPA Q9Y5I3 547 7 SNVTLQVFVLDENDNAPA O75284 546 7 SNVTLQVFVLDENDNAPA Q9Y5H7 546 7 SNVTLQVFVLDENDNAPA O75279 546 7 SNVTLQVFVLDENDNAPA Q9Y5I1 546 7 SNVTLQVFVLDENDNAPA O75281 547 7 SNVTLQVFVLDENDNAPA Q9Y5H6 547 7 SNVTLQVFVLDENDNAPT O88689 547 7 SNVTLQVFVLDENDNAPA O75278 547 7 SNVTLQVFVLDENDNAPA Q9UN75 547 7 SNVTLQVFVLDENDNAPA O75283 547 7 SNVTLQVFVLDENDNAPA Q9UN73 547 7 SNLTLQVFVLDENDNAPA O75280 546 7 SNLTLQVFVLDENDNAPA Q9Y5I2 546 7 SNVSLSLFVLDQNDNAPE Q9Y5D1 544 7 SNVSLSLFVLDQNDNAPE Q9Y5G7 544 7 SNVTLQVFVLDENDNAPT O88690 547 7 SNVSLSLFVLDQNDNAPE Q9Y5D8 545 7 SNVSLSLFVLDQNDNAPE Q9Y5H2 545 7 SNVSLSLFVLDQNDNAPE Q9Y5D9 545 7 SNVSLRLFVLDQNDNAPE Q9Y5C9 544 7 SNVSLRLFVLDQNDNAPE Q9Y5G4 544 7 SNVSLNLFVLDQNDNAPE Q9Y5D4 544 7 SNVSLNLFVLDQNDNAPE Q9Y5H0 544 7 SNVSLSLFVLDQNDNTPE Q9Y5D2 544 7 SNVSLSLFVLDQNDNTPE Q9Y5G8 544 7 SRVPLYIKVLDVNDNAPE CAD6_RAT 470 118 SNVSLSLFVLDQNDNAPE Q9Y5E0 548 7 SNVSLSLFVLDQNDNAPE Q9Y5H3 548 7 SRVPLYIKVLDVNDNAPE CAD6_HUMAN 470 118 SNVSLSLFVLDQNDNAPE O60330 544 7 SNVSLSLFVLDQNDNAPE Q9Y5D7 544 7 SRVPVFIKVLDVNDNAPE Q90762 470 118 SNVSLSLFLLDQNDNAPE Q9Y5D6 544 7 SNVSLSLFLLDQNDNAPE Q9Y5H4 544 7 SRVPVAIKVLDVNDNAPE O54800 478 118 SRVPLYIKVLDVNDNAPE CAD6_MOUSE 470 118 SEALVRVLVLDANDNSPF Q9Y5E8 543 7 SEALVRVLVLDANDNSPF Q9Y5E2 543 7 SRVPVAIKVLDVNDNAPE Q9ULB2 478 118 SRVPVAIKVLDVNDNAPE CAD8_MOUSE 478 118 SEALVRVLVLDANDNSPF Q9Y5E4 542 7 SNMSLSLFVLDQNDNPPE Q9Y5D0 544 7 SNMSLSLFVLDQNDNPPE Q9Y5G6 544 7 SEALVRVLVLDANDNSPF Q9Y5E6 543 7 SNVSLSLFVLDQNDNAPE Q9Y5D5 544 7 SNVSLSLFVLDQNDNAPE Q9Y5H1 544 7 SRVPVAIKVLDVNDNAPE CAD8_HUMAN 471 118 ANVSLRVLVDDRNDNAPR Q9UN64 542 7 ANVSLRVLVDDRNDNAPR Q9UN71 542 7 ANVSLRVLVGDLNDNAPR Q9UN65 544 7 ANVSLRVLVGDLNDNAPR Q9Y5G2 544 7 SNMSLSLFVLDQNDNAPE O15039 544 7 SNMSLSLFVLDQNDNAPE Q9Y5G5 544 7 SEALVRVLVLDANDNSPF Q9NRJ8 543 7 SEALVRVLVLDANDNSPF Q9Y5E1 543 7 ANVSLRVLVGDRNDNAPR Q9Y5C5 544 7 ANVSLRVLVGDRNDNAPR Q9Y5F9 544 7 TRVPVYVRILDVNDNAPQ CADA_CHICK 471 118 ANVSLRVLVGDRNDNAPR Q9Y5C6 540 7 ANVSLRVLVGDRNDNAPR Q9Y5G0 540 7 SEALVRVLVLDANDNSPF Q9Y5E7 545 7 ANVSLRVLVGDLNDNAPR Q9Y5C8 540 7 ANVSLRVLVGDLNDNAPR Q9Y5G3 540 7 SEALVRVLVLDANDNSPF Q9Y5F1 543 7 SEALVRVLVLDTNDNSPF Q9Y5E5 542 7 TRVAVFVRILDANDNAPQ Q9Y6N8 471 118 SEALVRVLVLDANDNSPF Q9Y5F2 543 7 AKVPVAIRVLDVNDNAPK Q15066 470 118 SNVSLSLFVLDQNDNVPE Q9Y5D3 544 7 SNVSLSLFVLDQNDNVPE Q9Y5G9 544 7 SEALVRLLVLDANDNSPF Q9Y5E3 541 7 SEALVRVLVLDANDNSPF Q9Y5E9 543 7 ANVSLRVLVGDRNDNAPR Q9UN63 544 7 ANVSLRVLVGDRNDNAPR Q9Y5F8 544 7 AQVPVAIRVLDVNDNAPK CADB_HUMAN 470 118 TKVPVAIRVLDVNDNAPK CADB_MOUSE 470 118 REALVRVLVLDANDNSPF Q9UN67 543 7 AKVPVAIKVVDVNDNAPK O93319 470 118 GNATVNILIVDQNDNAPA Q9Z1B1 556 8 GSVAVTIKVLDVNDNAPE Q9Z0M3 476 118 SQTLVRMVVLDDNDNAPF Q63418 542 7 GGVPVTIKVLDVNDNAPT Q91838 469 118 TRVPVAIKVLDKNDNAPE O93264 470 118 SIVQVHIEVLDENDNAPE CAD5_HUMAN 461 119 SHVTVGIRVLDVNDNPPE CADM_HUMAN 470 7 GRGYVAITILDINDNAPE Q90763 464 118 GRGYVAITILDINDNAPE Q9ULB5 464 118 SNVSLSLFVLDQNDNVPE Q9Z1B0 540 7 SQVTVRVVVLDDNDNRPM Q9Y5F3 544 7 SNVSLSLFVLDQNDNAPE O08963 540 7 ANVSLRVLVDDRNDNAPL Q9Y5C7 544 7 ANVSLRVLVDDRNDNAPL Q9Y5G1 544 7 SEALVRVLVLDANDNSPF Q9UN66 544 7 SHIPVFIRILDINDHAPE Q9ULB4 470 118 GTGTLQIYLLDINDNAPQ CAD2_MOUSE 587 120 GTGTLQIYLLDINDNAPQ Q9Z1Y3 587 120 SEALVRVVVLDANDNSPF Q9Y5F0 543 7 GTGTLQIYLLDINDNAPQ CAD2_CHICK 593 121 GTGTLQIYLLDINDNAPQ CAD2_HUMAN 587 120 GTGTLLLVLLDVNDNAPI CAD1_MOUSE 579 118 STVTVRLFVLDLNDNAPA Q9Y5C3 547 7 STVTVRLFVLDLNDNAPA Q9Y5F7 547 7 SRASLRIRILDVNDNPPE Q63315 478 118 SRASLRIRILDVNDNPPE Q63561 478 118 SRASLRIRILDVNDNPPE Q9WTP5 478 118 GTGTLQIYLLDINDNAPY CADO_XENLA 588 120 GTGTLLLILSDVNDNAPI CAD1_HUMAN 577 118 GTGTLLLILSDVNDNAPI Q15855 573 118 TNISVNIFVTDRNDNAPQ O60622 549 7 TNISVNIFVTDRNDNAPQ Q9UN70 549 7 TNISVNIFVTDRNDNAPQ Q9Y5C4 549 7 SRASLRIRILDVNDNPPE Q9UJ99 481 118 GTGTLQIYLLDINDNAPY CADN_XENLA 588 120 GTGTLLLVLSDVNDNAPI Q9R0T4 581 118 SNATVRVTVLDVNDNAPV O14917 565 8 GTGTLQIYLIDINDNAPE CAD4_CHICK 594 120 SIVQVYIEVLDENDNPPE CAD5_MOUSE 459 120 SIVQVYIEVLDENDNPPE O35542 460 120 TNLSVNVFVTDLNDNAPT O13129 546 7 GTGTLQIYLLDINDNAPR Q90275 464 121 TNISVNIFVTDRNDNAPQ Q08192 548 7 TNLTILVDVQDVNDNPPV Q24292 965 7 SSGLVSVQVLDVNDNAPI O35161 562 8 ATATVSLFVMDENDNAPT O60245 724 7 ATATVSLFVMDENDNAPT O60246 724 7 ATATVSLFVMDENDNAPT O60247 677 7 ATATVSLFVMDENDNAPT O88185 724 7 SKVNILINVLDVNEFPPE CADC_HUMAN 471 118 SRATVHVRLLDRNDNPPV Q9R0M0 1006 215 GTGTLLLILSDVNDNAPI Q9UII7 596 118 STVTANVYVVDMNDHAPH Q9Y5F4 561 7 STVTANVYVVDMNDHAPH Q9Y5I4 561 7 SRATVHVRLVDQNDNSPV Q9NYQ7 1151 215 SSTSVSITVLDVNDNDPV Q9NYQ6 669 130 GTGTLQIYLIDINDNAPQ CAD4_MOUSE 594 120 GTGTLILHVLDVNDNGPV CADF_XENLA 592 117 GTGTLVLNLLDVNDNGPF CAD1_XENLA 571 117 ANTSLHVFVLDENDNAPA Q9Y5C2 546 7 ANTSLHVFVLDENDNAPA Q9Y5F6 546 7 ASASVTVTVLDVNDNRPE O88278 729 113 GTGTLLLLLQDVNDNGPT CAD1_CHICK 583 117 ATATVSLFVMDENDNAPS O57537 696 7 GTGTLLIQLIDINDNAPE P79883 603 120 ATVTINLFVVDRNDNYPV Q9Y5F5 537 7 ATVTINLFVVDRNDNYPV Q9Y5I5 537 7 SFIEVYIEVEDVNDNAPQ Q9WU10 1122 115 SSISVWVSLLDANDNAPE O55134 547 7 SVVPVVIHVIDENDNAPQ FAT_DROME 1135 7 GTGTLHITLEDVNDNVPS CADD_CHICK 567 120 GTGTLHITLEDVNDNVPS Q91353 567 120 GTGTLILHVLDINDNGPV CADB_XENLA 600 117 SSVDVEVNVLDINDNRPE Q9VEU1 1335 9 ATATIHINILDVNDNAPV Q9VGG5 1169 9 SSVSVWVSLLDANDNAPE Q9NPG4 547 7 DTTDVEIGVTDVNDNAPA Q9V5N8 989 7 AYVGVTINVLDENDNAPY Q08174 663 7 GTGTLLLTLIDVNDHGPV CAD3_HUMAN 530 117 STSRIVVSVLDINDNSPE Q9VW71 1278 220 TVIKVKVRVLDINDNPPR Q9VFH5 1611 426 SVVELQIEVLDVNDNAPE Q9VVG0 1152 10 ATASLSVEVADMNDNAPA Q9NRT8 446 7 GTGTLLITLEDVNDNAPF CADD_HUMAN 567 120 CTGTLGIILEDVNDNGPF DSC2_MOUSE 559 119 SFIEIYIEVEDVNDNAPQ FATH_HUMAN 1121 115 STTLIQVRVVDDNDNFPY O93508 546 7 CTGTLVVLLEDFNDHPPQ DSC1_MOUSE 559 120 GTGTLLITLEDINDNAPV Q9WTR5 567 120 CTGTLVVHLDDYNDHAPQ DSC1_HUMAN 559 120 STVPVRIHVSDVNDNKPA Q19482 1015 223 GTGTLLLTLTDINDHGPI CAD3_MOUSE 522 117 ATARVSVEVADVNDNAPA Q9NRT7 437 112 SSAKVTINVVDVNDNKPV Q9P2X5 655 7 NYTTVIIHVKDVNDNPPV O15943 1496 4 GNTTVIVTVLDEDDNAPR Q9TWY4 2124 7 GNTTVIVTVLDEDDNAPR YOG7_CAEEL 2128 7 TRVQLNLRIVDQNDNCPV O93509 549 7 CTGTLVVFLEDKNDHPPQ DSC1_BOVIN 558 121 STSRVVVCILDVNDNPPM O88277 1224 112 SNALVQVRVLDQNDHSPV Q9WVR2 591 7 SSALVQVRVLDQNDHAPV O95206 591 7 CTGTLGIILQDVNDNSPF DSC2_HUMAN 559 119 STSRVVVGILDVNDNPPI Q9NYQ8 1224 326 TFTNLTIFVSDINDNAPT O01912 1426 4 GFANVTIKVTDMNDNAPF Q9XWM6 1295 229 SVSEFHLILMDVNDNPPR Q12864 649 7 ATARVSVEVADVNDNAPA Q9NRU2 436 7 STGTVYVRVPDFNDNCPT DSG3_HUMAN 477 125 STADFHLVLTDVNDNPPR Q9R100 648 7 STAYFHLVLMDVNDNPPR CADL_RAT 648 7 AITTVTVDIGDVNDNAPA Q19319 2673 397 DTTSVEIIVQDENDNAPE Q9VAF5 987 9

User query: Display/Full Code "CADHERIN"